KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_3917Help
Entry
Rleg_3917         CDS       T00926                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rleg_3917
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rleg_3917
Enzymes [BR:rlg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Rleg_3917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3990454..3991389
Genome map
AA seq 311 aa AA seqDB search
MNAQSRSVTLIGAPLEEGSGRRGAAMGPAALRIAGVDQTLIELGHDVADLGDLRIVPAMD
LPNHPKAHNLRIVGAFTRALESSVHDVAASGRFPLILGGDHSLSMGSVSGMARYAAGKDR
PLFVLWLDAHADFNSPATSPSGNIHGMPVAFFCGQAEFAEILPKGRPLVDPKNVFQVGIR
SVDAREREEIHEHGVNVFDMRAIDEQGIGATMREILDVVTKANGLLHVSLDLDFLDPEIA
PGVGTTVPGGATFREAHLVMEMLSDSGLVSSLDLVELNPFLDDRGKSARILVELTASLFG
RRIFDRPTRAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcccaatcgcgatctgtcaccctcatcggcgcgccgctggaagaaggctccggc
cgcagaggcgctgccatgggccctgcggccctgcgcattgccggcgtcgaccagacgctg
atcgagcttggccatgacgttgccgatcttggcgatctcaggatcgtaccggcgatggac
ctgccgaaccacccgaaggcccacaatctgaggatcgtcggtgccttcacccgcgcgctc
gaaagcagcgtccacgacgtcgcggcctccggccgtttcccgctgattctcggcggcgac
cacagcctttccatgggcagcgtctccggcatggcccgttatgccgccggcaaagatcgc
ccgctcttcgtgctctggctcgatgcccatgccgatttcaactctccggccacatcgcct
tccggcaatattcatggcatgcccgtcgccttcttttgtggccaagcggagttcgccgag
atcctgccgaagggccgtccgctcgtcgacccgaagaatgtcttccaggtcggcatccgt
tcggtcgatgcgcgcgagcgcgaggaaatccacgaacacggcgtcaacgtcttcgacatg
cgcgcgatcgacgagcagggtatcggcgccaccatgcgtgagatcctcgatgtcgtcacc
aaagcgaacggcctgctgcatgtcagcctcgatctcgatttcctcgatcccgagattgcg
ccgggcgtcggcacgacggttcctggcggcgcgacttttcgcgaggcgcatctggtgatg
gaaatgctttcggacagcggcctcgtctcgtcgctcgatctcgtcgagctcaatccgttt
ctcgacgatcgcggcaagagcgcccgcatcctggtggaactgacggcaagcctcttcggc
cgccgcatcttcgatcgtccgacacgcgccgcgtaa

DBGET integrated database retrieval system