KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_3917Help
Entry
Rleg_3917         CDS       T00926                                 

Definition
(GenBank) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rleg_3917
  Amino acid metabolism
   00220 Arginine biosynthesis
    Rleg_3917
   00330 Arginine and proline metabolism
    Rleg_3917
Enzymes [BR:rlg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Rleg_3917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3990454..3991389
Genome map
AA seq 311 aa AA seqDB search
MNAQSRSVTLIGAPLEEGSGRRGAAMGPAALRIAGVDQTLIELGHDVADLGDLRIVPAMD
LPNHPKAHNLRIVGAFTRALESSVHDVAASGRFPLILGGDHSLSMGSVSGMARYAAGKDR
PLFVLWLDAHADFNSPATSPSGNIHGMPVAFFCGQAEFAEILPKGRPLVDPKNVFQVGIR
SVDAREREEIHEHGVNVFDMRAIDEQGIGATMREILDVVTKANGLLHVSLDLDFLDPEIA
PGVGTTVPGGATFREAHLVMEMLSDSGLVSSLDLVELNPFLDDRGKSARILVELTASLFG
RRIFDRPTRAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcccaatcgcgatctgtcaccctcatcggcgcgccgctggaagaaggctccggc
cgcagaggcgctgccatgggccctgcggccctgcgcattgccggcgtcgaccagacgctg
atcgagcttggccatgacgttgccgatcttggcgatctcaggatcgtaccggcgatggac
ctgccgaaccacccgaaggcccacaatctgaggatcgtcggtgccttcacccgcgcgctc
gaaagcagcgtccacgacgtcgcggcctccggccgtttcccgctgattctcggcggcgac
cacagcctttccatgggcagcgtctccggcatggcccgttatgccgccggcaaagatcgc
ccgctcttcgtgctctggctcgatgcccatgccgatttcaactctccggccacatcgcct
tccggcaatattcatggcatgcccgtcgccttcttttgtggccaagcggagttcgccgag
atcctgccgaagggccgtccgctcgtcgacccgaagaatgtcttccaggtcggcatccgt
tcggtcgatgcgcgcgagcgcgaggaaatccacgaacacggcgtcaacgtcttcgacatg
cgcgcgatcgacgagcagggtatcggcgccaccatgcgtgagatcctcgatgtcgtcacc
aaagcgaacggcctgctgcatgtcagcctcgatctcgatttcctcgatcccgagattgcg
ccgggcgtcggcacgacggttcctggcggcgcgacttttcgcgaggcgcatctggtgatg
gaaatgctttcggacagcggcctcgtctcgtcgctcgatctcgtcgagctcaatccgttt
ctcgacgatcgcggcaagagcgcccgcatcctggtggaactgacggcaagcctcttcggc
cgccgcatcttcgatcgtccgacacgcgccgcgtaa

DBGET integrated database retrieval system