KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_3968Help
Entry
Rleg_3968         CDS       T00926                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg_3968
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rleg_3968
  Amino acid metabolism
   00310 Lysine degradation
    Rleg_3968
Enzymes [BR:rlg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rleg_3968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4043488..4044750)
Genome map
AA seq 420 aa AA seqDB search
MASEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPASGTLSEIV
VAAGETVGLGALLGQIAEGAAAAAAPAAAAPAAAPAQPAPAAAAQPAPVAAAASSSSASV
STMPPAPAASKMLAENNLSADQVDGSGKRGQVLKGDVIAAVAKGISAPAAAPAATPAAAR
GPSTVEDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMKAVMDLRNKYKDIFE
KKHGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDVIYKNYCHVGMAVGTDKGLVVPVIR
DADQMSIAEIEKELGRLAKAARDGSLSMADMQGGTFTITNGGVYGSLMSSPILNAPQSGI
LGMHKIQERPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagaaatccgcgttccaactctcggtgaatccgtcagcgaggcaaccgtcggc
acctggttcaagaaggtcggcgacgccatcaaggccgacgagccgattctcgagcttgaa
accgacaaggtgaccatcgaagttccagcacccgcctccggcacgctttcggaaatcgtc
gttgccgccggcgagaccgtcggcctcggcgcgctgctcggccagatcgctgaaggtgct
gccgctgctgccgcgccggctgccgctgcaccggctgccgcgcctgcccagccagccccg
gcggcggctgcccagccagccccggttgccgctgctgcgtcgtcatcgagcgcctccgtc
tccaccatgccgcctgcaccggcagcttcgaagatgcttgccgaaaacaacctttccgcc
gatcaggtcgacggtagcggcaagcgcggccaggtgctgaagggcgacgtcatcgctgcc
gtcgccaagggcatttccgccccggccgccgcacccgcagcaacgcctgccgccgcgcgt
ggtccgtcgacggtcgaggatgcctcgcgcgaagagcgcgtgaagatgacgcgcctgcgc
cagacgatcgccaagcgcctcaaggatgcgcagaacaccgccgccatgctgaccacctac
aacgaggtggacatgaaggcggtcatggatctgcgcaacaagtacaaggacattttcgag
aagaagcacggcgtcaagctcggcttcatgggcttctttaccaaggcggtgacgcatgcg
ctgaaggaactgccggccgtcaatgccgaaatcgacggcaccgacgtcatctacaagaac
tactgccatgtcggcatggccgtaggtacggacaaaggcctcgtcgttcccgtcatccgc
gacgccgaccagatgtcgatcgccgaaatcgagaaggaactcggccgtcttgccaaggca
gcccgtgatggctcgctctccatggccgacatgcagggcggcaccttcaccatcaccaat
ggcggcgtctacgggtcgctgatgtcttcgccgatcctcaacgcgccgcagtccggcatt
ctcggcatgcacaagatccaggagcggccggttgcgatcggcggccaggtcgtcatccgt
ccgatgatgtatctggcgctgtcctacgatcaccgcatcgtcgacggcaaggaagcggtc
accttcctcgtgcgcgtcaaggaaagcctggaagatccggaacgtctggttctcgatctc
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system