KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4013Help
Entry
Rleg_4013         CDS       T00926                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rlg00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:rlg00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4091559..4093238)
Genome map
AA seq 559 aa AA seqDB search
MTIYDELRKAPFNLDDAAISWIRDVYASLDLDDKIGQLFTLIMIGTDEEDFKRIASLRPG
GVTRFFTADLEFERRVISDLVAKSKVPPIISADLEGSRHSFAFGTPVLGQLGLAAVDDVQ
ATEKSSEILAREGRAMGVRWSFTPVIDINNAFRSPIVGTRSYGSDVNKIERHAVAHVHGL
QRNGVAATAKHWPGEGYDDRDQHLVTTTNPLSMDEWKETFGRLYGTLIAEGVLAIMSGHI
SLPAYVRSKMPDAGLEAFRPASVSRLLNVDLLRDELGFNGIIVSDATPMGGLSAWGHHLD
TLPDIIANGCDMILFSDEPEQDMAAVKGAIEDGRITPERLEEAVLRVLALKAHLKLFQPS
DVLPDAAEARHLLAHPDNVAASREYIGRSPTLVKDVNGIFPLDPAKTKRVLLVDGGIIHP
LMPQPLEFLLPALLRREGFEVTIDRPDIVPTPDDFDLVLYALGDESLLVRGRIFVDWHRM
GGGGLFKAMYRPWTNIPSVMISFGHPYHLYDAPRVPAYINAYSTMDSVQEAVVDCMLGRK
PFLGTNPVDPFCGLEDARY
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacgatctacgacgagcttcgcaaagcgccgttcaacctcgacgacgctgcgatatcc
tggatccgcgatgtctatgcctcgctcgatcttgatgacaagatcggccaactcttcacc
ttgatcatgatcgggacggatgaggaggatttcaaacgcattgcttcactaaggccgggc
ggcgtaacccgcttcttcacggctgacctcgagttcgagcggcgggtcatctctgacctc
gtggccaagagcaaagtcccgcccatcatcagcgcagacctcgaaggcagccgtcattcc
ttcgctttcggcactccggtgctgggccaacttggccttgccgccgtcgacgacgttcag
gcgaccgagaaaagctcggaaatcctggcacgcgagggccgcgcgatgggcgtgcgctgg
tccttcacgccagtcatcgatataaataacgcgttccgatcgccgattgtcggtacgcgc
tcatacggctccgatgtcaacaagattgagcggcacgcggttgcccatgttcacggtctc
caacgaaatggcgttgccgccaccgcaaagcactggccgggcgagggatatgacgaccgc
gatcagcacctcgttacgacgaccaatccgctttccatggacgagtggaaggaaaccttc
ggtcggctctatggaacgttgatcgccgaaggcgtgttggcaatcatgagcgggcacatt
tcccttccggcctatgttcgatcgaagatgccagatgccgggcttgaagccttccgaccg
gcctcggtttcccggttgctgaacgttgatcttctccgagacgaactcggcttcaatggc
atcatcgtctctgacgcgacacccatgggagggctgtccgcctggggccaccacctcgat
acgctgcctgatatcatcgcaaatggctgcgacatgatcctcttcagcgatgaacctgag
caggatatggcggcggtcaagggtgccatcgaagatgggcgaattactccggaacgactt
gaggaagcggttcttcgcgtgctggcgctcaaggcccatctcaaactttttcaaccgtca
gacgtcctccccgatgcggcggaagcgcgccacctgcttgcgcatccagacaatgtcgca
gcatcaagggaatacatcggccgctcgcctacgcttgtgaaggacgtcaatggtatcttt
ccgctcgatccggcgaaaacaaagcgcgtgctgctggtcgacggcggcatcattcatccg
ctcatgccgcagccactggaattcttgctacccgcgctgttgcggagggaaggtttcgaa
gtcacgatcgaccgaccggacatcgtgccgacccccgacgacttcgacctcgtcctctac
gcgctaggcgacgagtcgctactcgtgcgaggtcggatattcgtcgactggcataggatg
ggtggtggaggcctcttcaaggccatgtaccgaccctggacgaatattccctccgtaatg
atctcctttgggcatccctatcacctttacgatgcgccgcgcgtaccggcctatatcaat
gcgtactccaccatggacagcgtccaggaagccgtcgttgattgtatgctcggtcgcaag
cccttcctcggtaccaacccggtagaccctttctgtggcctggaagatgcgcgctattga

DBGET integrated database retrieval system