KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4021Help
Entry
Rleg_4021         CDS       T00926                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rlg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4097944..4098651
Genome map
AA seq 235 aa AA seqDB search
MRVLVTRPAHSAERTAQRLRDLGHEPLLLPLRQPLHDSAAAAGALAATGSAIAVTSAEAI
RVLSALGEQLHPHLARPLFAVGETTAEEARSLGFRSVTSSQGNGRDLADLVATQGADGLL
YLAGMPRAETFEAGLRELGIRFSIAECYRMQPIVPGQPEIEAIFSRSRPDAILFYSRQTA
EDFFRVPELRSAVPEHSGIRILCLSEAVAEAIPAALKKSVEISPMADEKSLLSLL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgctcgtcacccgccccgcgcattcggccgagcgaacagcacaacgtttgcgc
gatttgggccatgagcccttgctgctgccgctgcgtcagccgctgcacgacagcgccgca
gccgcaggcgcacttgcagccaccggcagcgcaatcgcggtgaccagtgccgaagccatc
agggtcctctccgcgctcggcgagcaacttcacccgcatctcgcccgtccgctttttgcg
gtcggcgaaacgacggcggaagaagcgcgcagcctcggcttccgatcggtcacctcatcc
caaggcaatggccgcgatctcgccgatctcgtcgcgacgcagggagcggacgggttgctt
tatcttgccggcatgccgcgcgccgaaactttcgaagcaggattgcgcgaactcggcatc
cgcttttctatcgccgaatgctatcgcatgcagccgatcgttcccggccagcccgagatc
gaagcgattttctcaaggtctcgtcctgacgccattctcttctattcccggcagacggcc
gaggatttctttcgcgtgccggaactgcgatcagccgtgccggaacacagcggaatccgc
attctctgccttagcgaggccgttgcggaggccattccggcggctttgaaaaaaagcgtc
gagatttcaccgatggcggatgagaaaagtcttctgtcgctgctttga

DBGET integrated database retrieval system