KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4021Help
Entry
Rleg_4021         CDS       T00926                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00860  Porphyrin and chlorophyll metabolism
rlg01100  Metabolic pathways
rlg01110  Biosynthesis of secondary metabolites
rlg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rleg_4021
Enzymes [BR:rlg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Rleg_4021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACS58262
JGI: Rleg_4021
UniProt: C6AYV3
Position
4097944..4098651
Genome map
AA seq 235 aa AA seqDB search
MRVLVTRPAHSAERTAQRLRDLGHEPLLLPLRQPLHDSAAAAGALAATGSAIAVTSAEAI
RVLSALGEQLHPHLARPLFAVGETTAEEARSLGFRSVTSSQGNGRDLADLVATQGADGLL
YLAGMPRAETFEAGLRELGIRFSIAECYRMQPIVPGQPEIEAIFSRSRPDAILFYSRQTA
EDFFRVPELRSAVPEHSGIRILCLSEAVAEAIPAALKKSVEISPMADEKSLLSLL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgctcgtcacccgccccgcgcattcggccgagcgaacagcacaacgtttgcgc
gatttgggccatgagcccttgctgctgccgctgcgtcagccgctgcacgacagcgccgca
gccgcaggcgcacttgcagccaccggcagcgcaatcgcggtgaccagtgccgaagccatc
agggtcctctccgcgctcggcgagcaacttcacccgcatctcgcccgtccgctttttgcg
gtcggcgaaacgacggcggaagaagcgcgcagcctcggcttccgatcggtcacctcatcc
caaggcaatggccgcgatctcgccgatctcgtcgcgacgcagggagcggacgggttgctt
tatcttgccggcatgccgcgcgccgaaactttcgaagcaggattgcgcgaactcggcatc
cgcttttctatcgccgaatgctatcgcatgcagccgatcgttcccggccagcccgagatc
gaagcgattttctcaaggtctcgtcctgacgccattctcttctattcccggcagacggcc
gaggatttctttcgcgtgccggaactgcgatcagccgtgccggaacacagcggaatccgc
attctctgccttagcgaggccgttgcggaggccattccggcggctttgaaaaaaagcgtc
gagatttcaccgatggcggatgagaaaagtcttctgtcgctgctttga

DBGET integrated database retrieval system