KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4133Help
Entry
Rleg_4133         CDS       T00926                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00010  Glycolysis / Gluconeogenesis
rlg00052  Galactose metabolism
rlg01100  Metabolic pathways
rlg01110  Biosynthesis of secondary metabolites
rlg01120  Microbial metabolism in diverse environments
rlg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg_4133
   00052 Galactose metabolism
    Rleg_4133
Enzymes [BR:rlg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Rleg_4133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACS58374
JGI: Rleg_4133
UniProt: C6AZW6
Position
complement(4215702..4216724)
Genome map
AA seq 340 aa AA seqDB search
MSDKLERDVFGQTQAGETVYRVVIKGGGLTAKIISWGAVIQDLRLEGHDAPLQLGFDDFD
SYPLYSSYFGATPGRCANRVGGGRFTLDDKDYQLELNENGVTHLHGGSDNIAKRNWTIVE
HDVDRVVLKIVDPDGRAGYPGNCTIQATFWVHGNGELSITYESTCDQPTLANVCQHAYFN
LDGREDALGHDIMIAADRYLPTDEKQVPTGEICSVEGTEFDFREMAPMKRFVGSEQAFYD
HNFCLSGERTAKRSVALARSLYSGVSLEVRSTEPGVQFYAGFKLDTAAPGIGGRKYGPFA
GFCLETQVWPDAINHQGFPNAVLRPGEVLRQETDYIFTKN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcggataagttggagcgggacgttttcgggcagacgcaggcgggcgagaccgtctat
cgcgtcgtgatcaagggcggtgggctgacggccaagatcatcagctggggcgcggtcatc
caggatctgcgtctcgagggacatgatgcgccgctgcagctcggctttgacgatttcgac
agctaccccctctattcatcctatttcggcgcgacacccggccgctgcgccaaccgcgtc
ggcggcggcaggtttacgcttgacgacaaggactatcagctcgaactgaatgaaaacggc
gtgacgcatctgcatggcggcagcgacaatatcgcaaaacgcaattggacgattgtcgag
catgacgtcgaccgcgtagtactgaagatcgtcgatcccgatggccgcgccggctatccc
ggcaattgcaccatccaggcgactttctgggtgcatggcaacggtgaactgtcgatcacc
tatgaatcgacctgcgaccagccgacgctcgccaatgtctgccagcacgcctatttcaat
ctcgacggccgggaagatgcgcttggccacgatatcatgattgccgccgatcgctatctg
ccgaccgatgagaagcaggtgccgaccggcgagatctgttccgtcgagggcacggaattc
gatttccgcgagatggcgccgatgaagcgtttcgtcggcagcgaacaagccttttacgac
cataatttctgcctgtcgggcgagcgtaccgccaagcggagcgtcgcgcttgcccgcagc
ctttattccggtgtgtcgctggaagtgcgcagcaccgagccaggcgtgcagttctatgcc
ggcttcaagctcgataccgcggcccccggcatcggcgggcgcaaatacggcccattcgcc
ggcttctgcctggagacgcaggtctggccggatgccatcaatcaccaaggttttccgaat
gcggttctgcgccccggcgaagtgctgcgtcaggagacggattatatcttcaccaagaac
tga

DBGET integrated database retrieval system