KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4199Help
Entry
Rleg_4199         CDS       T00926                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rleg_4199
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rleg_4199
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Rleg_4199
Enzymes [BR:rlg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Rleg_4199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4293475..4294644
Genome map
AA seq 389 aa AA seqDB search
MTSRKPLGRYRRIVIKIGSALLVDRKAGLKKAWLDAMCADISGLKAKGIDVLVVSSGAIA
LGRSVLDLPSGALKLEESQAAAAVGQIALARAWSESLSRDEIVAGQILLTLGDTEERRRY
LNARATINQLLKIGAVPIINENDTVATSEIRYGDNDRLAARVATMTGADLLILLSDIDGL
YTAPPHLDPNATFLETIAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATASGCAMIIA
SGKTDNPLSAIENGARSSWFAPSGTPVTARKTWIAGQLQPAGELHVDDGAVTALGAGKSL
LPAGVRSVSGLFSRGDTVAVIGPAGREIARGLVSYDADDARRIAGRKSAEIEAILGYAGR
AAMVHRDDMVMTAQIGSKSERQKKDASYA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccgtaagccgcttggccgctaccgccgcatcgtcatcaagatcggatctgcg
cttctggtcgaccgcaaggccgggctgaagaaggcctggctcgacgccatgtgcgccgat
atctcaggcctgaaggctaaaggcatcgatgtgctcgtcgtctcctcgggggcaatcgcg
ctcggccgctcggtgctcgacctgccctcgggcgcgctgaagctggaggaaagccaggcg
gccgccgccgtcggccagatcgcgctggctcgtgcctggtcggagagcctgtcacgcgac
gagatcgtcgccggtcagatcctgctgacgctcggcgataccgaggagcgccgccgctat
ctcaatgcgcgcgccaccatcaatcagcttttgaagatcggcgccgtgccgatcatcaat
gaaaacgacaccgtcgccaccagcgagatccgctatggtgacaatgatcgcctcgccgcc
cgcgtcgcgacgatgaccggcgccgatctgctcatccttctctccgacatcgacggcctc
tacaccgcgccgccgcatctcgatccgaacgcgacgttcctggaaacgattgccgaaatc
acccccgagatcgaggcgatggccggcggtgcggcctccgagctttcgcgcggcggcatg
cgcaccaagatcgatgccggcaagattgcgacggcatcaggctgcgccatgatcatcgcc
tccggcaagaccgacaatcctctgtcggcaatcgaaaacggcgcgcgttcctcgtggttc
gcgccgtcgggcacacccgttaccgcccgcaagacctggattgccggccagttgcagccg
gccggcgaactgcatgtcgatgacggcgccgtcacagccctcggcgccggcaagagcctg
cttcccgccggcgtgcgcagcgtttccggcctcttcagccgcggcgatacggtggcggtc
atcggcccggccggccgcgagatcgcccgcggccttgttagctacgatgccgacgacgcc
cgtcggattgccggccgcaagtcggcggagatcgaggccatcctcggttatgccgggcgc
gccgccatggtccatcgcgacgacatggtgatgaccgcgcagatcggttcgaaatcggaa
aggcagaagaaggacgcgagctatgcttga

DBGET integrated database retrieval system