KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4245Help
Entry
Rleg_4245         CDS       T00926                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00010  Glycolysis / Gluconeogenesis
rlg00620  Pyruvate metabolism
rlg00640  Propanoate metabolism
rlg00680  Methane metabolism
rlg01100  Metabolic pathways
rlg01110  Biosynthesis of secondary metabolites
rlg01120  Microbial metabolism in diverse environments
rlg01130  Biosynthesis of antibiotics
rlg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg_4245
   00620 Pyruvate metabolism
    Rleg_4245
   00640 Propanoate metabolism
    Rleg_4245
  Energy metabolism
   00680 Methane metabolism
    Rleg_4245
Enzymes [BR:rlg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rleg_4245
Lipid biosynthesis proteins [BR:rlg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rleg_4245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACS58485
JGI: Rleg_4245
UniProt: C6B077
Position
complement(4345560..4347515)
Genome map
AA seq 651 aa AA seqDB search
MSEKIYPVTKPVKARALIDKEKYLKWYEESVENPDKFWGKHGKRIDWFKPYTKVKNTSFT
GKVSIKWFEDGQTNVSYNCIDRHLKTNGDQVAIIWEGDNPYIDKKVTYNELYEHVCRMAN
VLKKHGVKKGDRVTIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPEALAGRIVDCESTF
VITCDEGLRGGKPVPLKNNTDTAIDIAARQHVIVEKVLVVRRTGGKTGWAPGRDLWHHQE
IATVKAECPPVKMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAAMTHEYVFDYHHGDV
YWCTADVGWVTGHSYILYGPLANCATTLMFEGVPNFPDQGRFWEVIDKHKVNIFYTAPTA
IRSLMGAGDDFVTRSSRSSLRLLGTVGEPINPEAWEWYYNVVGDKRCPVIDTWWQTETGG
HMITPLPGATDLKPGSATTPFFGVKPQLVDNEGKVLEGPADGNLCITDSWPGQMRTVYGD
HERFIQTYFSTYKGKYFTGDGCRRDADGYYWITGRVDDVLNVSGHRLGTAEVESALVSHN
LVSEAAVVGYPHPIKGQGIYCYVTLMAGHEGSDTLRQELVKHVRGEIGPIAAPDKIQFAP
GLPKTRSGKIMRRILRKIAEDDFGALGDTSTLADPAVVDDLIANRQNKATT
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagaagatctatccggtcacgaagccggtgaaggcgcgcgccctgatcgataag
gaaaagtacctgaaatggtacgaggaaagcgtcgagaacccggacaagttctggggcaag
cacggcaagcggatcgactggttcaagccctataccaaggtcaagaacacatcctttacc
ggcaaggtttcgatcaagtggttcgaggacggtcagacaaacgtctcctacaactgcatc
gaccgtcatctgaaaacgaatggcgaccaagtggcgatcatttgggaaggcgacaacccc
tatatcgacaagaaggtcacctataacgaactctacgagcacgtctgccggatggcgaat
gtgttgaagaagcacggcgtcaagaagggcgatcgcgtcaccatctatatgccgatgatc
ccggaagcggcttatgcgatgctcgcctgcgcccgcatcggcgcggtgcattcggtcgtc
ttcggcggtttctcgcccgaggcgctggccgggcgcatcgtcgactgcgaatccaccttc
gtcatcacctgcgacgaaggcctgcgcggtggcaagccggtgccgttgaagaacaatacc
gataccgcaattgacattgcggcacgccagcacgtgatcgtggagaaggttctggtcgtt
cgccgcaccggtggcaagaccggctgggcgccgggtcgcgatctctggcatcaccaggag
atcgccaccgtgaaggcggaatgcccgccggtgaagatgaaggcggaagatccgctcttc
attctttatacgtccggctcgaccggcaagccaaagggcgtgctgcacacgacggggggt
tatctcgtctatgcagcgatgacgcatgagtatgtcttcgattatcaccacggcgacgtt
tactggtgtacagccgatgtcggctgggtgaccggccattcctatatcctctatgggccg
cttgcgaactgcgcaacgacgctgatgttcgagggcgtgccgaacttcccggatcagggt
cgtttctgggaagtcatcgacaagcacaaggtcaacatcttctatacggcgccgacggcg
atccgctcgttgatgggtgccggcgacgacttcgtcacgcgctcctcgcgttcttcgctg
cgcctgctcggcacggtcggcgagccgatcaatcccgaggcctgggagtggtattacaat
gtcgtcggcgacaagcgatgccctgtcatcgatacgtggtggcagacggaaaccggcggt
cacatgatcacgccgctgcccggcgccaccgacctgaagcccggctcggcgacgacgccg
ttcttcggcgtcaagccgcagctggtcgacaatgagggcaaggtgctggaaggtccggcc
gacggtaatctttgcatcaccgacagctggccgggccagatgcgcacggtctatggcgat
cacgagcgcttcatccagacctatttttctacctacaagggcaagtatttcaccggcgat
ggctgccggcgcgatgcggacggttattactggatcaccggccgggtcgacgacgtgctg
aacgtctccggccaccggctcggtacagcggaggtggaatccgctctcgtctcgcataat
ctggtttcggaagccgcggtcgtcggttatccgcatccgatcaagggccagggcatctat
tgctacgtgacgctgatggccggtcatgagggatcggatacgcttcgccaggaactggta
aaacatgtgcggggtgaaatcggcccgattgctgcgcctgacaagatccagtttgcgccc
ggcctgccgaagacacgctccggcaagatcatgcgccgcatcctgcgcaagattgccgaa
gacgatttcggcgctctcggcgacacttcgacgcttgccgatccggccgtggtcgacgat
ctgatcgccaaccggcaaaacaaggcaaccacctga

DBGET integrated database retrieval system