KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4281Help
Entry
Rleg_4281         CDS       T00926                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rleg_4281
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rleg_4281
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rleg_4281
Enzymes [BR:rlg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rleg_4281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4383285..4384505
Genome map
AA seq 406 aa AA seqDB search
MNETPKPNSFRSGPDEDGRFGIYGGRFVAETLMPLILDLQDEWNRAKNDPAFQAELKHLG
AHYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKNRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGSGTLKD
AMNEALRDWVTNVEDTYYLIGTAAGPHPYPEMVRDFQSVIGIEAKEQMLAAEGRLPDLVI
AAVGGGSNAIGIFHPFLDDPSVKIVGVEAGGKGLQGDEHCASITAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHSWLNDTGRVDYVPIMDHEALEAFQTLTRLEGIIPA
LEPSHAIAEVIKRAPTMGKDEIILMNLSGRGDKDIFTVGKLLGMGL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgagacgcctaaaccgaattccttccgttccggccccgatgaagatggccgtttc
ggcatatatggcggtcgtttcgtcgccgaaacactcatgccgctgatcctggatctgcag
gacgagtggaacagggcgaagaacgatccggcattccaggccgaattgaagcatctcggc
gcgcattatatcggccgcccgagcccgctctatttcgccgagcggctgacggccgaactc
ggcggcgcgaagatctatttcaagcgcgaggagctgaaccataccggctcgcacaagatc
aacaactgcatcggccagatcctgctcgccaagcgcatgggcaagaaccgcatcatcgcc
gaaaccggggccggccagcacggcgtcgcctccgcgaccgtggccgcccgctttggcctt
ccctgcgtcgtctatatgggcgccaccgacgtcgagcgtcaggcgccgaacgttttccgc
atgaaactgctcggcgcggaagtcaaaccggtcaccgcaggcagtggcacgctcaaggac
gccatgaacgaggcgcttcgcgactgggtcaccaatgtcgaagatacctattacctgatc
ggaacggccgccggtccgcatccctatccggagatggtccgcgatttccagtcggtgatc
ggtatcgaagcgaaggagcagatgctggcggccgaaggccgtcttccggatctggtcatc
gctgccgtcggcggcggctcgaacgccatcggcattttccatccttttctggatgatccc
tctgtcaagatcgtcggcgtcgaagccggcggcaagggtctgcagggcgacgaacattgc
gcctcgatcaccgccggttcgccgggcgtgctgcacggcaaccgcacctacctgctgcag
gatggtgacggtcagatcaaggaaggccattcgatttcggccggcctcgattatcccggc
atcggccccgaacattcctggctgaacgataccggccgcgtcgactatgtgccgatcatg
gaccacgaagcgctcgaggctttccagaccctgacccgcctcgaaggcatcatcccggcg
ctcgagccctcgcatgcgattgccgaggtcatcaagcgggcaccgacgatgggcaaggac
gagatcatcctaatgaacctctccggccgcggcgacaaggatatcttcaccgtcggcaag
cttctgggaatgggactgtaa

DBGET integrated database retrieval system