KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4282Help
Entry
Rleg_4282         CDS       T00926                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rleg_4282 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rleg_4282 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rleg_4282 (trpA)
Enzymes [BR:rlg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rleg_4282 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4384509..4385348
Genome map
AA seq 279 aa AA seqDB search
MTARMDKRFAELKAEGRPALVTYFMGGDPDYDTSLGIMKALPEAGSDIIELGMPFSDPMA
DGPAIQLAGQRALKGGQTLKKTLQLAADFRKTNDATPIVMMGYYNPIYIYGVEKFLDDAL
AAGIDGLIVVDLPPEMDDELCIPAIRKGINFIRLATPTTDEKRLPKVLKNTSGFVYYVSM
NGITGSALPDPSLVSGAVERIKQHTSLPVCVGFGVKTAEHAKVIGGSADGVVVGTAIVNQ
VATSLTHDGKATADTVQAVATLVRGLSTGTRSARLVAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggacaaacgctttgccgagctgaaggccgagggccgtccggcgctt
gtgacctatttcatgggcggcgatcctgactacgacacctcgcttggcatcatgaaggcg
ctgccggaggcgggctcagacattatcgagctcggcatgcccttttccgatccgatggcc
gacggcccggcgatccagctggccggccagcgcgcgctgaaaggcggccagacgctgaag
aagacgctgcagctggcggccgatttccgcaagaccaacgatgcgacgccgatcgtgatg
atgggttactacaacccgatctatatttacggcgtcgagaaattcctcgacgacgcactc
gccgccggcatcgacggcctgatcgtcgtcgacctgccgcccgagatggatgacgaactc
tgcattccggcgatccgcaagggcattaatttcattcgcctggcgacgccgacgaccgat
gagaagcgcctgccgaaggtattgaagaacacctccggcttcgtctactacgtctcgatg
aacggcatcaccggttcggcgctgcccgatccgtcgctggtttcgggcgcggtcgagcgc
atcaagcagcataccagcctgcccgtctgcgtcggcttcggcgtcaagacggcggaacat
gcaaaggtcatcggcggttcggccgacggcgtcgtcgtcggcaccgcgatcgtcaatcag
gtcgcgaccagcttgacgcatgacggaaaggcaacggcggacaccgttcaggccgttgcc
acgctggtgcgtggcctttccacgggaacacgttcggcgcgccttgttgctgccgaatag

DBGET integrated database retrieval system