KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4314Help
Entry
Rleg_4314         CDS       T00926                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg_4314
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rleg_4314
   00630 Glyoxylate and dicarboxylate metabolism
    Rleg_4314
Enzymes [BR:rlg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rleg_4314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4419336..4421507
Genome map
AA seq 723 aa AA seqDB search
MSRVDKNGLAIETVLHDFLVKEVLPGLAVDADKFFADFSAVVHDLAPKNRALLAKRDELQ
VKIDDWYRRHGAPADMDDYQSFLRDIGYLLPEGSDFQVSTENVDPEIASIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPESDGAQKGKGYNPKRGEKVIAWVRDFLDTSAPL
QDCRWKDVGGFAVRDGALSVRSIDGEQAMLTDGKHFAGYRGDPAAPTHILLKNNGIHIEI
VIDATTTIGKADPADISDVWLESAITTIMDCEDSIAAVDAEDKVVVYRNWLGLMKGDLQE
EVAKGGTSFIRRLNPDLQYAGPDGAAFEVHRRSLMLVRNVGHLMTNPAILDRDGNEVPEG
IMDAVITGLIALYDIGPSGRRKNSRTGSMYVVKPKMHGPEEVAFAVEIFSRVEDALGLLR
NAIKMGIMDEERRTTVNLKECIRTARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMR
QAAWISAYENWNVDIGLECGLAGHAQIGKGMWAMPDLMAAMLEQKITHPKAGANTAWVPS
PTAATLHATHYHRVNVARVQQGLKDRARAKLSDILSVPVAVRPNWTPEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHKVVTEAQIVETMKR
MAAVVDGQNASDTAYQPMADNFDDSIAFQAALDLVLKGREQPNGYTEPVLHRRRRELKAK
QAA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgttgataagaacggtcttgccatcgaaaccgtccttcatgatttcctcgtc
aaggaggtgctgccgggcctggcggtcgatgcggacaagttctttgccgatttttcggct
gtagtccacgatctcgccccgaagaatcgtgcgctgctggcaaaacgcgatgagctgcaa
gtaaagatcgacgactggtaccgccggcacggcgccccggcagatatggacgattaccag
tccttcctccgcgacatcggctatctcctgccggaaggatcggacttccaggtctcgacc
gaaaatgtcgatccggagatcgcatcgatcgccggcccgcagctcgtcgttcccgtcatg
aatgctcgctatgccctgaatgccgccaatgcccgctggggttcgctctatgatgcgctc
tacggcacggacgccattcccgagagcgacggcgcccaaaaaggcaagggctacaatccg
aaacgcggcgagaaggtcatcgcctgggtgcgcgatttcctcgatacatcagcgccgctg
caggactgccggtggaaggacgttggcggcttcgccgtcagggatggagcgctctctgtc
agatcgatcgatggcgagcaggccatgctgacggatggcaagcattttgccggctatcgc
ggagatcccgccgccccgacgcatattctcctgaagaacaacggcattcacatcgaaatc
gtcatcgatgcgacgacgacgatcgggaaagccgatccggccgatatttccgatgtctgg
ctggaatcggcaattacgacgatcatggactgcgaggattcgattgccgctgtcgatgcc
gaggacaaggtcgtcgtctatcgcaactggctcggcctgatgaagggcgacctgcaggaa
gaggtggcaaaaggcggaacgagcttcatccgcaggctcaatccggatctgcaatatgcc
ggcccggatggtgccgccttcgaggtgcaccgccgctcgctgatgctggtacgcaatgtc
ggccacctcatgaccaacccggcgatcctcgaccgcgacggcaatgaagtgcctgagggc
atcatggatgctgttatcaccggcctgatcgcgctttacgatattggtccctccggccgg
cggaagaattcccgcaccggctccatgtatgtggtcaaaccgaagatgcatgggccggaa
gaggtggccttcgccgtcgaaatcttctcgcgggtcgaagatgcgcttggcctgctgcgc
aatgccatcaagatgggcatcatggacgaggagcgccgcacgaccgtcaacctcaaggaa
tgcatccgtaccgcccgcgagcgcgtcgtcttcatcaataccggcttcctcgatcgcacc
ggcgacgagatccacacgtcgatggaagccggcccaatgattcgtaagggcgacatgcgc
caggcggcgtggatttccgcctatgaaaactggaacgtcgacatcggcctcgaatgcggc
cttgccggccacgcccagatcggcaagggcatgtgggcgatgccggatctgatggcggcg
atgctcgaacagaagatcacccacccgaaggccggcgccaacaccgcctgggtgccgtcg
ccgacggccgcaaccctgcatgccacccattaccaccgcgtcaatgtcgcccgtgtccag
caggggctgaaggatcgcgctcgcgccaagctctccgacattctctccgtgccggttgcg
gtgcggccgaactggacgccggaggaaatccagcgcgaactcgacaacaatgctcaaggc
atcctcggctacgtcgtgcgctgggttgatcagggcgtcggctgctcgaaggtgcccgac
atcaacaatgtcggcctgatggaagatcgcgcgacgctgcgcatttcggcccagcatatg
gcgaactggttgcatcacaaggtcgtcaccgaagctcagatcgtcgagacgatgaaacgc
atggccgccgtcgtcgacggtcagaatgcgtcggataccgcctatcagccgatggccgac
aatttcgacgactcgatcgccttccaggctgccctcgatctcgtcctcaagggtagggaa
cagccgaacggctacaccgagccggtgcttcaccgccgccgccgcgagctcaaggcgaaa
caggccgcgtga

DBGET integrated database retrieval system