KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4314Help
Entry
Rleg_4314         CDS       T00926                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg_4314
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rleg_4314
   00630 Glyoxylate and dicarboxylate metabolism
    Rleg_4314
Enzymes [BR:rlg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rleg_4314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4419336..4421507
Genome map
AA seq 723 aa AA seqDB search
MSRVDKNGLAIETVLHDFLVKEVLPGLAVDADKFFADFSAVVHDLAPKNRALLAKRDELQ
VKIDDWYRRHGAPADMDDYQSFLRDIGYLLPEGSDFQVSTENVDPEIASIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPESDGAQKGKGYNPKRGEKVIAWVRDFLDTSAPL
QDCRWKDVGGFAVRDGALSVRSIDGEQAMLTDGKHFAGYRGDPAAPTHILLKNNGIHIEI
VIDATTTIGKADPADISDVWLESAITTIMDCEDSIAAVDAEDKVVVYRNWLGLMKGDLQE
EVAKGGTSFIRRLNPDLQYAGPDGAAFEVHRRSLMLVRNVGHLMTNPAILDRDGNEVPEG
IMDAVITGLIALYDIGPSGRRKNSRTGSMYVVKPKMHGPEEVAFAVEIFSRVEDALGLLR
NAIKMGIMDEERRTTVNLKECIRTARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMR
QAAWISAYENWNVDIGLECGLAGHAQIGKGMWAMPDLMAAMLEQKITHPKAGANTAWVPS
PTAATLHATHYHRVNVARVQQGLKDRARAKLSDILSVPVAVRPNWTPEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHKVVTEAQIVETMKR
MAAVVDGQNASDTAYQPMADNFDDSIAFQAALDLVLKGREQPNGYTEPVLHRRRRELKAK
QAA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgttgataagaacggtcttgccatcgaaaccgtccttcatgatttcctcgtc
aaggaggtgctgccgggcctggcggtcgatgcggacaagttctttgccgatttttcggct
gtagtccacgatctcgccccgaagaatcgtgcgctgctggcaaaacgcgatgagctgcaa
gtaaagatcgacgactggtaccgccggcacggcgccccggcagatatggacgattaccag
tccttcctccgcgacatcggctatctcctgccggaaggatcggacttccaggtctcgacc
gaaaatgtcgatccggagatcgcatcgatcgccggcccgcagctcgtcgttcccgtcatg
aatgctcgctatgccctgaatgccgccaatgcccgctggggttcgctctatgatgcgctc
tacggcacggacgccattcccgagagcgacggcgcccaaaaaggcaagggctacaatccg
aaacgcggcgagaaggtcatcgcctgggtgcgcgatttcctcgatacatcagcgccgctg
caggactgccggtggaaggacgttggcggcttcgccgtcagggatggagcgctctctgtc
agatcgatcgatggcgagcaggccatgctgacggatggcaagcattttgccggctatcgc
ggagatcccgccgccccgacgcatattctcctgaagaacaacggcattcacatcgaaatc
gtcatcgatgcgacgacgacgatcgggaaagccgatccggccgatatttccgatgtctgg
ctggaatcggcaattacgacgatcatggactgcgaggattcgattgccgctgtcgatgcc
gaggacaaggtcgtcgtctatcgcaactggctcggcctgatgaagggcgacctgcaggaa
gaggtggcaaaaggcggaacgagcttcatccgcaggctcaatccggatctgcaatatgcc
ggcccggatggtgccgccttcgaggtgcaccgccgctcgctgatgctggtacgcaatgtc
ggccacctcatgaccaacccggcgatcctcgaccgcgacggcaatgaagtgcctgagggc
atcatggatgctgttatcaccggcctgatcgcgctttacgatattggtccctccggccgg
cggaagaattcccgcaccggctccatgtatgtggtcaaaccgaagatgcatgggccggaa
gaggtggccttcgccgtcgaaatcttctcgcgggtcgaagatgcgcttggcctgctgcgc
aatgccatcaagatgggcatcatggacgaggagcgccgcacgaccgtcaacctcaaggaa
tgcatccgtaccgcccgcgagcgcgtcgtcttcatcaataccggcttcctcgatcgcacc
ggcgacgagatccacacgtcgatggaagccggcccaatgattcgtaagggcgacatgcgc
caggcggcgtggatttccgcctatgaaaactggaacgtcgacatcggcctcgaatgcggc
cttgccggccacgcccagatcggcaagggcatgtgggcgatgccggatctgatggcggcg
atgctcgaacagaagatcacccacccgaaggccggcgccaacaccgcctgggtgccgtcg
ccgacggccgcaaccctgcatgccacccattaccaccgcgtcaatgtcgcccgtgtccag
caggggctgaaggatcgcgctcgcgccaagctctccgacattctctccgtgccggttgcg
gtgcggccgaactggacgccggaggaaatccagcgcgaactcgacaacaatgctcaaggc
atcctcggctacgtcgtgcgctgggttgatcagggcgtcggctgctcgaaggtgcccgac
atcaacaatgtcggcctgatggaagatcgcgcgacgctgcgcatttcggcccagcatatg
gcgaactggttgcatcacaaggtcgtcaccgaagctcagatcgtcgagacgatgaaacgc
atggccgccgtcgtcgacggtcagaatgcgtcggataccgcctatcagccgatggccgac
aatttcgacgactcgatcgccttccaggctgccctcgatctcgtcctcaagggtagggaa
cagccgaacggctacaccgagccggtgcttcaccgccgccgccgcgagctcaaggcgaaa
caggccgcgtga

DBGET integrated database retrieval system