KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4394Help
Entry
Rleg_4394         CDS       T00926                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rlg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4523628..4524233)
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLIKKKDQLLGPLSNAMGEAYDKVKIC
SRCGNVDTVDPCIVCTDVQRDQSVIIVVEDVSDLWALERAGAMNAAYHVLGGTLSPLDGV
GPDDLNIRGLIDRVGEGGMRELIIAVNATVEGQTTAHYITDQLQGLDVKITRLAHGVPVG
GELDYLDEGTLAAALRARTVI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgagtcaccggccccgaaatcgaaaaactcatccagcttctggcgaaggtg
ccgggcctcgggccgcgctcggcgcgccgggcggcactgcatctgatcaagaagaaggac
caactgctcggcccgctgtcgaatgcaatgggcgaggcctatgacaaggtgaagatctgc
tcgcgctgcggcaatgtcgatacggtcgatccctgcattgtctgcaccgacgtccaacgc
gatcaatccgtcatcatcgtcgtcgaggacgtctcggatctctgggcgctggaacgggca
ggcgcgatgaacgccgcctatcacgtgctcggcggcacgctgtcaccactcgacggggtc
ggtcctgacgatctcaatattcgcgggctgatcgacagggtcggcgaaggcggcatgcgg
gaactgatcatcgcggtcaatgccaccgtcgagggacagacgacagcgcactacatcacc
gaccagttgcaggggctcgatgtgaagatcacccggctggcgcatggcgtgcctgtcggc
ggcgaactcgactatctcgacgagggcacccttgcggcggcacttcgggcgcggacggtg
atatag

DBGET integrated database retrieval system