KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4443Help
Entry
Rleg_4443         CDS       T00926                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00010  Glycolysis / Gluconeogenesis
rlg00052  Galactose metabolism
rlg00500  Starch and sucrose metabolism
rlg00520  Amino sugar and nucleotide sugar metabolism
rlg00521  Streptomycin biosynthesis
rlg01100  Metabolic pathways
rlg01110  Biosynthesis of secondary metabolites
rlg01120  Microbial metabolism in diverse environments
rlg01130  Biosynthesis of antibiotics
rlg01200  Carbon metabolism
Module
rlg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg_4443
   00052 Galactose metabolism
    Rleg_4443
   00500 Starch and sucrose metabolism
    Rleg_4443
   00520 Amino sugar and nucleotide sugar metabolism
    Rleg_4443
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rleg_4443
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Rleg_4443
Enzymes [BR:rlg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rleg_4443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ACS58681
JGI: Rleg_4443
UniProt: C6B277
Position
complement(4576206..4577231)
Genome map
AA seq 341 aa AA seqDB search
MPKPNNSIAPQPFPILIGDIGGTNARFSILTDAYAEPKQFPNVRTADFATIDEAIQQGVL
DKTAVQPRSAILAVAGPINDDEIPLTNCDWVVRPKTMIEGLGMEDVLVVNDFEAQALAIA
ALSDENRERIGDATGDMIASRVVLGPGTGLGVGGLVHAQHSWIPVPGEGGHVDLGPRSKR
DYEIFPHIETIEGRVSAEQILCGRGLVNLYHAICVVDGIQPTMKDPADITSHALAGSDKA
AVETVSLFATYLGRVAGDMAMVFMARGGVYLSGGISQKIIPALKKPEFRIAFEDKAPHTA
LLRTIPTYVVTHPLAALAGLSSYARMPANFGVSTEGRRWRR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaccgaacaacagcatcgctccgcagcctttcccgatcctgatcggcgatatc
ggcggcacgaatgcccgcttctccatcctgaccgatgcctatgccgagccgaagcagttt
ccgaacgtgcgcacggcggatttcgccacgatcgacgaagcgatccagcaaggcgtgctc
gacaagaccgccgtgcagccgcgctcggcgatcctcgccgtcgccggcccgatcaacgac
gacgagatcccgctgaccaattgcgactgggtggtgcggccgaagacgatgatcgagggc
ctcggcatggaggatgtgctcgtcgtcaacgatttcgaggcgcaggcgctggcaatcgcc
gcgctttcggatgaaaaccgcgaacgcatcggcgacgccaccggcgacatgatcgcctcc
cgcgtcgtgctcggaccaggcaccggcctcggcgtcggcgggcttgtgcatgcccagcac
agctggatcccggttcccggcgaaggcggccatgtcgatctcgggccgcgcagcaagcgc
gattatgaaatcttcccgcatatcgagacgatcgaaggccgcgtttcggccgagcagatc
ctctgcgggcgcggcctcgtcaacctctaccatgccatctgcgttgtcgacggcatccag
ccgacgatgaaagatcccgccgacatcacctcgcatgcgcttgccggcagcgacaaggca
gccgtagagaccgtctcgctgtttgccacctatctcggccgcgtggcgggcgacatggcg
atggtgttcatggcgcgcggcggcgtctatctgtccggcggcatctcgcagaagatcatc
ccggcgctgaagaagccggaattccgcatcgccttcgaggacaaggcgccgcatacggcg
ctgcttcgcaccatcccgacctatgtggtgacgcatccgctggcagcgcttgccgggctt
tcctcctatgcgcggatgccggcaaatttcggcgtctcgaccgaaggccgccgctggcgg
cgctag

DBGET integrated database retrieval system