KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4499Help
Entry
Rleg_4499         CDS       T00926                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rleg_4499
Enzymes [BR:rlg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Rleg_4499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4633305..4634354)
Genome map
AA seq 349 aa AA seqDB search
MRTTRHLTALLFAAALTPSPVLAAEAPCYRGVNLSGGEYGERGGIYGTNYTYPSEDTIGY
FAKKGMTIIRLPFRWERLQPALGGRLDEDELKRIKDTIGLIRKHGMAVLLDPHNFGYYDK
TQVGTAPATDAAFGDFWARLAVEFANQDGVLFGLMNEPHDIKATDWLDAANAAIRSIRAV
GARNLILVPGTAWSGAGSWEKDVIGGANGTVMLGVRDPLNFYAYEVHQYLDADSSGTHPT
CEGASAAVAAINGVTAWLKQNHKRGFLGEFGASTDKDCMSGLTEIYATMSGNSDVWLGWS
YWAAGDWWPADEPFNVQPRKGPERPQMRLLAEAAKAGAGICSAVKPAGK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaggacgacacgacatctgacagcgctgctgtttgcggccgctctcaccccgtcgccg
gtccttgcggctgaggccccttgctaccgcggcgtcaatttgtccggcggtgaatatggc
gagcgcggcggcatctacggcaccaactacacctacccgagcgaagacacgatcggctat
ttcgccaagaagggcatgacgattatccggctgcccttccgctgggagcggctgcagccc
gcactcggcgggcggctcgacgaggatgagctcaagcggatcaaagatacgatcggcctg
atccgcaagcacggcatggcggttctgctcgacccgcataatttcggctattacgacaag
acccaggtcggcacagcgccggcgacggatgccgccttcggtgacttctgggcaaggctc
gccgtcgaattcgccaatcaggacggcgttctcttcggcctgatgaacgaaccgcacgac
atcaaggcgaccgactggctggatgcggccaatgcggcgatccgcagcatccgcgctgtc
ggcgcgcgcaacctcatcttggtgccgggcaccgcctggagcggcgcgggcagctgggaa
aaggatgtgatcggcggcgccaacggcacggtgatgctcggtgtgcgcgatccgctcaat
ttctacgcctatgaggtccaccagtatctcgatgccgattcctccggcacccatccgacc
tgtgaaggtgcgtccgccgcggtcgcggcgatcaacggcgttaccgcctggttgaagcag
aaccacaagcgcggttttctcggcgaatttggcgcctccaccgacaaggactgcatgagc
gggctgaccgaaatctacgccaccatgtccggcaatagcgatgtgtggctcggctggtcc
tactgggcggccggcgattggtggccggcggacgagccgttcaacgtccagccgcgcaag
ggccctgagcggccgcagatgcggcttcttgccgaggcggcaaaagccggtgccggcatt
tgctccgccgtcaaacccgcggggaaatga

DBGET integrated database retrieval system