KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4508Help
Entry
Rleg_4508         CDS       T00926                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00521  Streptomycin biosynthesis
rlg00523  Polyketide sugar unit biosynthesis
rlg01130  Biosynthesis of antibiotics
Module
rlg_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rleg_4508
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rleg_4508
Enzymes [BR:rlg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Rleg_4508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACS58746
JGI: Rleg_4508
UniProt: C6B344
Position
complement(4641933..4642475)
Genome map
AA seq 180 aa AA seqDB search
MKFLPTAVSGAFVVEVDARSDDRGMFARTFDAQTFAAQGLVPVYPQCNISQNHKRGTLRG
MHYQAQPRPEIKLVRATRGRVFDVAVDLRPDSPSYLKWASVELDAIRHNAFYIPAGCAHG
FLTLEDNCELFYQMSEAYVPELARGVRWDDPAFSIGWPFPPSIISERDAALDSYGQETSL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattccttccgaccgcggtttcgggcgcctttgtcgtggaagtcgacgcgcgctcc
gacgaccggggaatgttcgcacgaaccttcgacgcgcagacctttgcggcgcaaggtctc
gtccccgtctacccgcagtgcaatatctcgcagaaccacaagcgcgggacgctgcgcggt
atgcactaccaagcccaaccgcggccggagatcaagctggtgcgcgccacgcgcggcagg
gtattcgacgtggctgttgatctgaggccggattcgccgagctatctcaaatgggcctcc
gtcgagctcgatgctatcaggcacaatgccttctacatacctgccggatgcgcgcacggc
tttctgacgctcgaggataattgcgagctcttctaccagatgtcggaagcctatgtgccg
gaacttgcccgtggcgtccgctgggacgatcccgccttttccatcggctggccgttcccg
ccgagcatcatcagcgagcgcgacgcagcgcttgacagctacggccaggagacaagcctt
tga

DBGET integrated database retrieval system