KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_4508Help
Entry
Rleg_4508         CDS       T00926                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:rlg00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:rlg00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4641933..4642475)
Genome map
AA seq 180 aa AA seqDB search
MKFLPTAVSGAFVVEVDARSDDRGMFARTFDAQTFAAQGLVPVYPQCNISQNHKRGTLRG
MHYQAQPRPEIKLVRATRGRVFDVAVDLRPDSPSYLKWASVELDAIRHNAFYIPAGCAHG
FLTLEDNCELFYQMSEAYVPELARGVRWDDPAFSIGWPFPPSIISERDAALDSYGQETSL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattccttccgaccgcggtttcgggcgcctttgtcgtggaagtcgacgcgcgctcc
gacgaccggggaatgttcgcacgaaccttcgacgcgcagacctttgcggcgcaaggtctc
gtccccgtctacccgcagtgcaatatctcgcagaaccacaagcgcgggacgctgcgcggt
atgcactaccaagcccaaccgcggccggagatcaagctggtgcgcgccacgcgcggcagg
gtattcgacgtggctgttgatctgaggccggattcgccgagctatctcaaatgggcctcc
gtcgagctcgatgctatcaggcacaatgccttctacatacctgccggatgcgcgcacggc
tttctgacgctcgaggataattgcgagctcttctaccagatgtcggaagcctatgtgccg
gaacttgcccgtggcgtccgctgggacgatcccgccttttccatcggctggccgttcccg
ccgagcatcatcagcgagcgcgacgcagcgcttgacagctacggccaggagacaagcctt
tga

DBGET integrated database retrieval system