KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_5099Help
Entry
Rleg_5099         CDS       T00926                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00500  Starch and sucrose metabolism
rlg01100  Metabolic pathways
rlg01110  Biosynthesis of secondary metabolites
Module
rlg_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rleg_5099
Enzymes [BR:rlg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Rleg_5099
Exosome [BR:rlg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rleg_5099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ACS59312
JGI: Rleg_5099
UniProt: C6B5F4
Position
pR132501:495286..497496
Genome map
AA seq 736 aa AA seqDB search
MNVERSELLAGIGQDALWALIDGRHGDPFSILGPHQTGGMTIVRAYLPGAEAVDLIEAAT
GRVVTPFSIAHPSGLFAAAAASRTGYRLRITWPDAVQITEDPYSFGLLLGELDLHLISEG
THYSLSRTLGAVDMSIDGISGVRFAVWAPNARRVSVVGDFNAWDGRRNPMRLRPSAGVWE
LFIPRLAPGERYKFEIVDAQGTCLPQKADPVARASEAAPSTASIVASSTPFRWTDDGWMK
GRSRQDRLEGAFSVYEVHVGSWLRDQKDGNRSLDWVELSQRLVPYVSDMGFTHIELLPIM
EHPFGGSWGYQPLGLFAPTGRYGTPEDFAYFVDRCHGAGLGVILDWVPAHFPTDAWGLAR
FDGSALYEHEDPREGFHRDWNTLIYNLGRNEVKGFLIASALEWLERYHIDGLRVDAVASM
LYRDYSRNEGEWIPNQYGGRENLEAVEFFKHLNSIIHERCPHAMTIAEESTAWPGVTKPP
EQGGLGFDIKWNMGWMHDSLSYIEKDPIYRSYAHGTMTFGMIYAYSERFILPISHDEVVY
GKGSLLAKMPGDEWQKFANLRSYLAFMWGHPGKKLLFMGSEIAQPGEWNHDGSVTWDVLD
RPQHVGIQRLVKDLNGLYADEPALQFGDFHPEGFEWAAADDAVNSVLGMLRYAPDRASPV
LVMSNFTPVPRYGYRVGVPSDGVWIEKMTTDAREYGGSGLVNGAVSTEPVPAHGRPVSLA
LTLPPLSTIFLQGPSP
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttgagcgctcggaacttctggcgggcatcggccaggatgcgctatgggccttg
atcgacgggcgccatggtgatcctttttcgatcctcggtccccaccaaaccggtggcatg
acgatcgtgcgggcctatctgcccggagcggaagctgtcgatctcatcgaggcagcgacc
ggtcgggtggtgacgccgttcagcatcgcccatccgtccggcctgttcgcggcagcagcc
gcgtcgaggacgggataccggctgcggatcacatggccggatgccgtgcagatcaccgag
gatccctacagtttcggcctgctgctcggagagctcgaccttcatctgatatcggagggc
acccactatagtctgagccggacgcttggcgcggttgatatgtcgatcgacgggatatcg
ggtgttcgtttcgccgtctgggcaccgaatgcgcgccgcgtctcggtggtcggcgacttc
aatgcctgggatgggcggcgcaatccgatgcggctgagaccgtcggcgggcgtctgggag
ctgtttattccgcgcctcgcccccggcgaaagatacaagttcgagatcgtcgatgcacaa
gggacttgcctgccgcagaaggccgatccggtggccagggcgagcgaggccgccccttcg
accgcttccattgtcgcatcgtcgacgccgtttcgatggaccgatgacggttggatgaag
ggacggtcccgacaagacagactggagggcgccttctccgtctatgaagtgcacgtcggc
tcctggcttcgcgatcaaaaggacggcaacaggtcgctcgactgggtcgaactcagccag
cggctggttccctatgtcagcgacatgggctttacccatatcgagctgcttccgatcatg
gagcatccgttcggcggctcctggggctatcagccgctcggtctgttcgctcccaccggc
cgatacgggacgcctgaggatttcgcttatttcgtcgaccggtgccatggcgccgggctc
ggcgtcatcctcgactgggtgccggcccatttccccacagatgcctgggggcttgcccgc
ttcgacggcagcgcgctctacgagcatgaagatccgcgcgaaggctttcaccgcgactgg
aacacgctgatctacaatctcggccgcaacgaggtgaagggattcctgatcgccagcgcg
ctggaatggctggagcgctaccatatcgacggtttgcgggtcgacgccgttgcctcgatg
ctctaccgcgactacagccgcaacgagggcgaatggattcccaaccaatatggcggtcgc
gagaatctggaagcggtcgaattcttcaagcatctgaacagcatcattcacgagcgctgc
ccgcacgcgatgacgatcgccgaggaatcgacggcctggcccggggtgacgaagccgccg
gagcaaggggggctgggcttcgacatcaagtggaacatgggctggatgcatgacagcctg
agctacatcgagaaggatccgatttaccgcagttacgcccatggcacgatgaccttcggc
atgatctatgcctattccgagcgcttcattctgccgatttcacatgacgaggtcgtctac
ggaaagggctcgctgctggcgaaaatgccgggcgacgaatggcagaagttcgccaatctg
cgcagctatctcgccttcatgtggggtcatcccggcaaaaagctcttgttcatggggagc
gaaatcgcccagcctggcgagtggaaccatgatgggtcggtgacctgggatgtgctggac
cggcctcagcatgtcggcattcagcggctggtgaaggatctaaacggcctttacgccgac
gagcctgcattgcagttcggtgactttcatcccgagggtttcgaatgggcggcagccgac
gacgccgtcaattccgtcctcggcatgctgcgttatgcgcccgatcgcgcttcaccggtg
ctggtcatgtcgaatttcacgccggtgccgcgttacggctacagggtcggcgtgcccagc
gacggtgtgtggatcgagaagatgacgacggatgcgcgggaatatggcggttcgggcctg
gtcaatggcgcggtgtcgactgaacccgtgcccgcccacggcaggcccgtctccctggcg
ctgacgctgccgccgctatcgacgatttttctgcaggggccgtcgccttga

DBGET integrated database retrieval system