KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_5113Help
Entry
Rleg_5113         CDS       T00926                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rleg_5113
Enzymes [BR:rlg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Rleg_5113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pR132501:514247..516106
Genome map
AA seq 619 aa AA seqDB search
MKPAEFDKLARRHGISPTRPSPDNREVAISAETKRKILSALKIDVPGSADPATCALRPKP
AAKKIARSFLPDFLSGTRVWGVSLQLYELRSARNWGIGDFEDLSDMADLAGSLGADFIGL
TPLHAPFLADPDRCSPYEPSSRQHLNPLYIAVERLPGFACGPELERHLESLRQTDLVDYV
GVAQIKLRVLRDLWPAWRQSSVIDDAYDPADFDAFITQGGNNLRLHALFECLSFSMVERG
TGAGWQRWPADFQRFESAAVAEFEREHADDVLFHMWLQWLAHRQLMQAADRARKAGLRIG
LYLDLAVGEAVDGSATWSEPDTYVSKATIGSPPDPFAVDGQDWHLAGYLPSAIAAGEMSP
FRRMLSAAMRYAGAIRIDHAAALRRLFLVPLGSRPDGGAYVCYPADRLLQILAEVSAEHR
CLVIGEDLGLIPKGLQDDLATAHILSYRILSYEQDEKGFKPADVYPALALACISTHDHQT
LAGWWRGADIQARCDHGIVPPDLTKKHLEDRKRERRNLKAALKAAGLELPARLFQARASE
ETLRELTVSAYRFIARTPSLLAAVRLADLTDEKRPTNVPGTSDSYPNWKPKLSVLLADLM
SSPLLKSVTAAMREERPRE
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgctgagttcgacaagctcgcccgtcggcacggcatcagcccgaccaggccc
agtcccgacaatcgggaggtggcgatatcagccgagaccaagcgcaagatcctctcggca
ctcaagatcgacgtgccgggaagcgccgatcccgcgacctgcgcgttacggcccaagccg
gcggctaagaaaatcgccaggtcatttctgcccgatttcctttccggcacgcgcgtctgg
ggcgtgagcctgcagctctacgagctccgttcggcgcgcaactggggcataggagatttc
gaggatctgtcggatatggcggatctcgcaggatcgttgggcgccgatttcatcggcctc
accccgcttcatgcgccgtttctcgccgatccagaccgttgcagtccctacgagccgtcg
agccgccagcatctcaacccgctctatatcgcggtcgagcgattgccgggttttgcctgc
ggtcccgaactcgaacggcatttggaaagccttcgccaaaccgatctcgtcgactacgtc
ggcgtcgcacagatcaagctgagggtcctgcgcgatctttggccggcctggcgacagagc
agcgtgatcgacgatgcctatgatccggccgatttcgacgccttcatcacgcaaggtggt
aacaacctgcggctgcatgcgcttttcgaatgcctctcgttttccatggtcgagcgcggg
acaggcgccggctggcaacgttggccggccgatttccagcgcttcgaaagcgccgccgtt
gccgaattcgagcgcgaacacgcggacgacgtccttttccacatgtggctgcaatggctc
gcccaccggcaactgatgcaggcggcggaccgggcgcggaaggcaggcctgcggatcggg
ctctatctcgatcttgccgtcggggaggcggtcgacggttcggcgacatggagcgagccg
gatacctatgtctcgaaggccaccatcggcagcccacccgatccattcgccgtggacggg
caggactggcaccttgccggatatctgccttccgcgatcgcggcaggagaaatgtcgcct
ttccggcgcatgctgagcgctgccatgcgatatgcgggcgccatccgcatcgaccacgcc
gcagcacttcgccgcctcttcctggtgccattgggcagcaggccggacggcggcgcctat
gtctgttatcccgcggatcggctgctgcagatcctcgccgaagtgtccgcagagcatcgg
tgcctcgttatcggagaagacctgggcctgatccccaagggattgcaggacgatcttgcg
acggcccacattctctcctaccgcatcctttcctatgaacaggacgagaagggcttcaag
ccggcggacgtctatcccgccctggctttggcctgcatttcgacgcatgaccaccaaacc
cttgccggctggtggcgcggcgccgacattcaggcccggtgcgaccacggcatcgtgccg
cccgatctcaccaagaagcacctcgaagaccgcaagcgcgagcggaggaacctgaaagcg
gcgctgaaggctgccggcctcgaactgccggccaggcttttccaagcgcgggcaagcgag
gagacgctgagggaattgaccgtcagcgcttatcgcttcatcgccaggacgccctcgctt
ctcgccgcggtccgtctcgccgatctcaccgacgaaaaaaggccaaccaatgtgccaggc
accagcgacagctatccgaactggaagccgaagctatcggttttgctcgccgatctgatg
tcgagcccgctgctgaagagcgtgacggcggcaatgcgggaggaacgtccgcgggagtga

DBGET integrated database retrieval system