KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_5226Help
Entry
Rleg_5226         CDS       T00926                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg_5226
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg_5226
   00052 Galactose metabolism
    Rleg_5226
   00500 Starch and sucrose metabolism
    Rleg_5226
   00520 Amino sugar and nucleotide sugar metabolism
    Rleg_5226
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rleg_5226
   00524 Butirosin and neomycin biosynthesis
    Rleg_5226
Enzymes [BR:rlg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rleg_5226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pR132501:637733..638698
Genome map
AA seq 321 aa AA seqDB search
MQQVAIGIDLGGTQVRAALVDEQGRILARAAEPTDALAGPDRVLAQICGLTDGLLAASNP
ASVVGVGVSAPGPLDTVAGVASNIPTLSGFVDFPLKAELQKRFPFPVDLENDAIAAAIGE
WQFGAGTGLDNLVYVTVSTGIGGGVVSDGRVVRGRKGMAAHVGHMSVVPNGELCPCGNRG
CFEAYGSGTAFARRAQIRAVESSATTIGSDGGAIDSRSVFAAARNGDRLANQLIDEEAEI
LGRGFTSLIHIFSPDIIVMGGGLSHEFDRLQPGIQGYITQWAMPAFKDVRVMLAALDQNS
GLVGAAALAFLTGKVPAVDQI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggttgccattggaatcgacctcggtgggacgcaggtgcgcgctgccctcgtc
gacgagcagggcaggattctggcgcgcgcagccgaaccgacggatgcgttggcgggcccc
gaccgcgtgctcgcccaaatctgcggcctgaccgacggactgcttgcagcatcgaacccc
gcttcggtggtgggcgtcggcgtatccgctccgggcccgctcgatacggtcgccggtgtc
gcctcgaatatcccgaccctctccggctttgtcgactttccgctgaaggcggagttgcag
aagcggtttccgtttccggtcgacctcgagaatgatgcgattgccgctgccatcggtgag
tggcagttcggagccggaacggggctcgacaatttggtgtatgtcaccgtgagcactggc
attggcggtggcgttgtgtcggatggtcgcgtcgtgcgcggccgcaagggcatggcagcc
catgttgggcacatgtcggtcgtgccgaacggagagctttgcccctgcggcaacaggggt
tgtttcgaggcctacggatccggaacggcatttgcgcgccgcgcccaaatcagggctgtg
gaatccagcgcgacgacaataggcagcgatggcggcgccatcgatagccgcagcgttttt
gcagcagcaagaaatggcgatcgtctcgcaaatcaactgattgacgaggaagcggaaatt
ctcggtcgcggcttcaccagcctgatccatatcttcagtcccgatatcatcgtgatggga
ggcggtctttcccacgagttcgaccgactgcaacccggcattcaaggctacatcacgcaa
tgggcaatgccggcattcaaggatgtcagggtaatgctggcggcgttggaccagaactcg
ggcctcgtcggcgcagctgctctggcgtttctgaccggaaaggtcccggcggtcgatcag
atttag

  All links  
No link information was found.   
DBGET integrated database retrieval system