KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_5328Help
Entry
Rleg_5328         CDS       T00926                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg_5328 (tpiA)
   01230 Biosynthesis of amino acids
    Rleg_5328 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg_5328 (tpiA)
   00051 Fructose and mannose metabolism
    Rleg_5328 (tpiA)
   00562 Inositol phosphate metabolism
    Rleg_5328 (tpiA)
Enzymes [BR:rlg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rleg_5328 (tpiA)
Exosome [BR:rlg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rleg_5328 (tpiA)
  Exosomal proteins of bladder cancer cells
   Rleg_5328 (tpiA)
  Exosomal proteins of melanoma cells
   Rleg_5328 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pR132501:736586..737356
Genome map
AA seq 256 aa AA seqDB search
MTEKPRFWIGTSWKMNKTLAEAEHFARGLEAADAARDPRIQRFVIPSFTAVREVKAMLAT
TSVKVGAQNMHWADQGAWTGEVSPVMLKDCNLDLVELGHSERREHFGETDETVGLKTEAA
VRHGLVPLICIGETLSDRESGKAADILATQVRGALSKLSGAQKSAEILLAYEPVWAIGEK
GIPATADYADARQSEIIAVAETVLGRKIPCLYGGSVNPQNCEELISSPHIGGLFIGRSAW
NVEGYLDILAKCAAKL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaagccgcgcttctggattggcaccagctggaagatgaacaagacgcttgct
gaagcggagcatttcgcccgcggtctcgaagctgccgatgccgcgcgcgacccgcgtatc
cagcgtttcgtcattccgtctttcaccgccgtgcgcgaggtcaaggcgatgcttgccacg
acctcggtgaaggtcggcgcccagaacatgcattgggccgaccagggcgcctggaccggc
gaagtctcgccggtaatgctgaaggactgcaatctcgatctcgtcgagctcggccattcg
gaacggcgcgaacattttggtgagaccgacgagactgtgggtctgaagaccgaagcagcc
gttcgccacggtctcgttccgctgatctgcattggcgagacgctttccgaccgcgaaagc
ggaaaggctgccgacatcctcgcaacccaggtgcgcggcgcgctgtcgaaactttcgggc
gcccagaaaagcgccgaaatcctgctcgcctacgagccggtctgggcgatcggcgagaag
ggcattccggcgactgcggattatgccgatgcccgccagtctgaaatcatcgccgttgcc
gaaacggtgctgggtcggaagatcccctgcctttatggtgggtcggtcaacccgcagaac
tgcgaagaactgatttcgagcccgcatatcggcgggctcttcatcggccgttcggcctgg
aatgtcgaaggttacctcgacatcctggccaaatgcgccgccaaactctga

DBGET integrated database retrieval system