KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_5328Help
Entry
Rleg_5328         CDS       T00926                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Brite
Enzymes [BR:rlg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     Rleg_5328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pR132501:736586..737356
Genome map
AA seq 256 aa AA seqDB search
MTEKPRFWIGTSWKMNKTLAEAEHFARGLEAADAARDPRIQRFVIPSFTAVREVKAMLAT
TSVKVGAQNMHWADQGAWTGEVSPVMLKDCNLDLVELGHSERREHFGETDETVGLKTEAA
VRHGLVPLICIGETLSDRESGKAADILATQVRGALSKLSGAQKSAEILLAYEPVWAIGEK
GIPATADYADARQSEIIAVAETVLGRKIPCLYGGSVNPQNCEELISSPHIGGLFIGRSAW
NVEGYLDILAKCAAKL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaagccgcgcttctggattggcaccagctggaagatgaacaagacgcttgct
gaagcggagcatttcgcccgcggtctcgaagctgccgatgccgcgcgcgacccgcgtatc
cagcgtttcgtcattccgtctttcaccgccgtgcgcgaggtcaaggcgatgcttgccacg
acctcggtgaaggtcggcgcccagaacatgcattgggccgaccagggcgcctggaccggc
gaagtctcgccggtaatgctgaaggactgcaatctcgatctcgtcgagctcggccattcg
gaacggcgcgaacattttggtgagaccgacgagactgtgggtctgaagaccgaagcagcc
gttcgccacggtctcgttccgctgatctgcattggcgagacgctttccgaccgcgaaagc
ggaaaggctgccgacatcctcgcaacccaggtgcgcggcgcgctgtcgaaactttcgggc
gcccagaaaagcgccgaaatcctgctcgcctacgagccggtctgggcgatcggcgagaag
ggcattccggcgactgcggattatgccgatgcccgccagtctgaaatcatcgccgttgcc
gaaacggtgctgggtcggaagatcccctgcctttatggtgggtcggtcaacccgcagaac
tgcgaagaactgatttcgagcccgcatatcggcgggctcttcatcggccgttcggcctgg
aatgtcgaaggttacctcgacatcctggccaaatgcgccgccaaactctga

DBGET integrated database retrieval system