KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_5368Help
Entry
Rleg_5368         CDS       T00926                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rlg00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rlg00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:rlg00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pR132501:complement(777760..779076)
Genome map
AA seq 438 aa AA seqDB search
MPKICLVGAGSTVFAQNILGDVLSSQRGGDYVISLFDIDPERLKTSEIVARRICESLKLS
SVRIDATLDRREALRGSDFVILMMQVGGYKPATVTDFDIPKKYGLRQTIADTLGIGGIFR
GLRTIPVLEAICRDMQEVCPQALLMQYVNPMAINCWAIKELAPEIRTVGLCHSVQHTAGH
LAQCLGEDIADVNYISAGINHVAFFLKYEKVHSDGRREDLYPRLNALATDGRVPSDDRVR
FDVLKRLGHFVTESSEHFSEYTSWYIKEGRGDLIDQLNIPLDEYIRRCEVQIKEWHALRK
ELEGDKPIEVCRSNEYAAGIIHAAVTGSPALIYGNVPNNGLIENLPDECIVEVPCHVDRN
GIQPVRVGRIPSQLAAVMNLSVSVQQLTVEAALTKNRERIYQAALLDPHTSAELSPDQIW
NLVDDLIVAHGDLLPRYQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagatttgcctggtaggcgctggtagcaccgtttttgcacagaacattctggga
gacgtcctgtcctcgcagagaggcggcgactacgtcatcagcctcttcgatatcgatccc
gagcgactgaagacgtcagagatcgtcgctcgccggatctgcgagtcgcttaagctttca
agtgtcaggatcgacgccacgctcgaccggcgggaagcgctgcgggggtcggatttcgtc
atcctcatgatgcaggtcggtggctacaagccggctaccgtcacggacttcgacattccg
aaaaaatatggcttgcgtcagacgatcgccgacacccttggcatcggcggcattttccgc
ggtttgcggacgataccagtccttgaggcgatctgccgagacatgcaggaggtctgcccg
caggctcttctgatgcagtacgtcaacccgatggccatcaactgctgggcgatcaaggag
ctggccccggaaatccgcaccgtcggcttgtgtcatagcgtgcagcacacagccgggcat
ctcgcgcaatgcctcggcgaggacattgccgacgtgaactatatttcggccgggatcaat
cacgtcgccttcttcctgaaatatgagaaagttcacagcgacggacggcgggaagatctt
tatccgagactgaacgctctcgccaccgatggccgcgtcccgtcggacgatcgggtgcgg
ttcgatgtgctcaaacgcctcggccacttcgtcaccgaatccagcgagcatttctccgag
tatacctcctggtacatcaaggagggacgaggggatctgatcgatcagctcaatatcccg
ttggacgaatacatccggcgctgcgaggtgcagatcaaagaatggcatgccctgcgcaag
gaactggaaggggacaagccgatcgaggtgtgccgcagcaatgaatatgcggccggcatc
attcatgccgcggtcactggcagcccggcgctgatatacggtaatgtcccaaacaacggc
ctgatcgagaatctgcccgatgaatgcatcgtggaagtgccttgccatgtcgacagaaac
ggaattcagccggtccgggtcggtcggatcccctctcagcttgccgccgtcatgaacttg
agcgtttccgttcagcagttgacggtcgaggcggctcttacaaaaaaccgcgagcgcatc
taccaggccgctctgctcgatccgcatacgtctgcggaattgtcgccagaccaaatctgg
aaccttgtcgacgacctgatcgtcgcacacggcgatttgttgccgagatatcagtga

DBGET integrated database retrieval system