KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_5947Help
Entry
Rleg_5947         CDS       T00926                                 

Definition
cytochrome c oxidase, subunit I (EC:1.9.3.1)
Orthology
K02274  
cytochrome c oxidase subunit I [EC:1.9.3.1]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Rleg_5947
Enzymes [BR:rlg01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     Rleg_5947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pR132503:complement(491383..493047)
Genome map
AA seq 554 aa AA seqDB search
MPRNDATHLNTNLHREGLSQTREERVSYLRAGHSLRSWLLSTDHKRVAILYLIAITFFFF
IGGVAAALVRADLLTPQGDLLTNEGYNRAFTLHGVIMVWFFLIPSIPNTFGNFLIPLMIG
ARDLAFPRLNLLSWYIFVLAGLFTLIVVVTGGVDTGWTFYTPLSSMFSNGNVVLAATAVF
IAGFSSILTGLNFIVTIHKLRCPGMTWGRLPLFVWSHYATSLVLVLATPVLSVTLVLIVA
ERFFHLGVFDPALGGDPLLYQHLFWFYSHPAVYIMVLPALGVVSELIAAAARKPVFGYQF
VAGSSMAIAAIGFLVWGHHMFVSGQSMYASAAFSLLSLAVAVPSGIKVYNWTATLYKGHI
GLDPPFLFAMGFIGLFVVGGLTGLMLAMLAIDLHVHDTYFVVAHFHYIMVGGTVSAFFGA
LHYWWPKIIGRRYNHIWGSITAIFIFLGFNMTFFPQFLLGYWGMPRRYHVYPPEFQTLHV
LSSAGATILGFAYLTPFVYLFYSMRYGQPAGDNPWDARGLEWTVPSPPPKHNFDHLPVVS
GPPYDYPVEREGEQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcaatgatgcaacgcacttaaacaccaatctccatcgagaggggctttcccag
actcgggaggaacgcgtcagctatttgagggcaggccacagtctgcgctcatggcttcta
tcgacggaccataagcgtgtcgcgattctttatctcatcgcaattacattcttcttcttc
atcggcggcgtcgccgctgctcttgtgcgcgcggatctcctgacaccgcagggagatttg
ctgaccaatgagggctacaatcgtgccttcaccctccacggcgtgatcatggtctggttc
ttcctcattccgtctattccgaacacgtttggcaatttcctgatcccgctgatgatcggc
gcgcgcgaccttgcgttcccgcgcctcaatctcctgagctggtatatctttgtattggct
ggcttgttcacattgattgtggtggtcaccggcggcgtcgataccggatggacattctac
acgccgctctcctccatgttttcgaacggaaacgttgttcttgcagcgacggcggttttc
atcgccgggttctcgtccattctaaccgggctgaacttcatcgtcacgatccacaagctt
cgatgcccgggtatgacctggggtcgtctgccgctctttgtctggtcgcattacgcgaca
tcgctcgttcttgtcctggcgacgcctgttttgtcggtcacgctggtgctgatcgtcgct
gaacgctttttccacctcggcgtcttcgatcctgctctgggtggcgatcctctgctttac
cagcacctgttctggttctacagccatcctgcggtctatatcatggtgctcccggcactc
ggggtggtcagcgagctgatagctgctgccgcccgcaaacccgtgtttggttatcagttc
gtggctgggtcctccatggcgatcgccgcaattggcttccttgtctgggggcatcacatg
ttcgtttccggccagtcgatgtacgccagcgccgcgttctcattactgagcttggccgtc
gcggttccgtcaggcatcaaggtctataattggaccgcaaccctctataagggccacatt
ggcctcgatccgccgtttctctttgccatgggcttcatcggtctgttcgttgtcggcgga
ttgactgggctcatgctcgccatgctggctatcgacctccacgtccacgacacctatttc
gtggtggcgcattttcactacattatggttggcggtaccgtatccgccttcttcggcgcc
ctgcactattggtggccgaagatcatcggccgccgctacaaccacatctggggcagtatt
actgccattttcatttttcttggattcaacatgacttttttcccgcagttcctgttgggt
tactggggcatgccacggcgctaccatgtgtacccgcccgagttccagaccctgcacgta
ctgtcgtctgccggagcgaccattcttgggttcgcctatctaacgcccttcgtctacctg
ttctattccatgcgttatggccaacctgcgggtgataacccttgggatgcacgtggactg
gagtggacggtgccatcgccgccgccgaagcacaacttcgaccatctgccggtcgttagc
ggccccccttacgattatccggtggagcgggagggcgaacaatga

DBGET integrated database retrieval system