KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_5976Help
Entry
Rleg_5976         CDS       T00926                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rlg00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pR132504:complement(4737..6239)
Genome map
AA seq 500 aa AA seqDB search
MSGYILSIDQGTTSSRAIVFDSDMKMAGSAQAEITQYYPQPGWVEHDAAEIWQSVVDTVR
KAIADAGLDAADIAAIGITNQRETAVVWDRRSGTPLHHAIVWQDRRTAEMCESLKADGYE
KLFSAKTGLLLDPYFSGTKLRWLLDNVDGLREKAEVGDVCFGTIDSWLIYNLTDGRVHAT
DATNASRTLLYNIDDGAWDEELLGILRIPAAMLPDVRECADDFGRVDKALFGAELPILGV
AGDQQAAAMGNACFEPGMMKSTYGTGCFALLNTGRDRVSSSNRMLTTIACRLDGETTYAL
EGSIFIAGAAVQWLRDGLGIIGQASEAGVLAAKADPGQQVYIVPAFTGLGAPYWDPAARG
AIFGLTRNSGPAEFARAVLESVAYQTLDLLVAMKKDWGVNQLETVLRVDGGMAASDWTMQ
CLADMTGNPVDRSAIRETTALGAAWLAGSKAGIWPGKRDFAQAWACDRRFSPSMDETERQ
GKIIGWKNAVSRMISDASAG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcggctatattctttcaatcgaccagggcacgacctcctcgcgcgcgatcgtcttc
gacagcgacatgaaaatggccggctcggcgcaggcggagatcactcaatattatccgcag
cccggatgggtggagcacgacgctgccgaaatctggcagtccgtcgtcgatactgtgcgc
aaggcgatcgccgatgccggacttgatgccgccgacattgccgcgatcggcattactaat
cagcgcgagactgcggtcgtctgggatcgcaggtccgggacaccgcttcaccacgcgatc
gtctggcaggacaggcgcacggccgaaatgtgcgagagcctgaaggccgatggatacgag
aagctgttcagcgccaagaccgggctgctgctcgacccttatttctccggaacgaagctg
cgctggctgctcgacaatgtcgatggcctacgtgagaaggcggaagtgggcgatgtctgc
ttcggcacgatcgacagctggctgatctacaatttgactgatggacgcgtgcatgccacc
gatgcgaccaatgcatcgaggacgctgctctacaatatcgatgacggcgcctgggatgag
gagcttctcggcattcttcgcattccggccgccatgcttcctgacgtcagggaatgtgcc
gatgatttcggccgcgtcgacaaggcgctgttcggtgcggagcttccgatcctgggtgtc
gccggcgaccagcaggcggcggcgatgggcaatgcctgcttcgagcccggcatgatgaaa
tccacctatggcaccggctgctttgccctgctgaacaccggccgggatcgtgtttcctct
tccaaccggatgctgacgacgatcgcctgccggctcgacggcgagacgacctatgcgctc
gaaggctcgatcttcatcgccggtgccgccgtgcaatggctgcgcgacggcctcggcatc
atcggccaggcatccgaggcgggggtgcttgccgccaaggccgatcccggacagcaggtc
tacatcgttccggccttcaccggtctcggcgcgccctattgggatccggccgcgcgtggc
gcgatcttcggtctgacacgaaacagcgggccggcggaatttgcccgcgccgtgcttgaa
tccgtcgcctaccagacgctcgatctgctggtggcgatgaagaaggactggggcgtcaac
cagctggaaacggtgctgcgcgtcgatggcggcatggcggcttcggattggacgatgcag
tgcctggccgacatgaccggaaaccctgtcgaccgctcggcgatccgcgagacgacggcg
ctgggcgcagcctggctcgccggttcgaaagccggcatctggccaggcaagcgggatttt
gcgcaggcctgggcctgcgaccgccgcttcagcccttcgatggatgagaccgagcggcag
ggcaagatcatcggctggaagaatgccgtctccagaatgatttcggacgcctccgcggga
tag

DBGET integrated database retrieval system