KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_6168Help
Entry
Rleg_6168         CDS       T00926                                 

Definition
PfkB domain protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rleg_6168
Enzymes [BR:rlg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Rleg_6168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pR132504:214153..215046
Genome map
AA seq 297 aa AA seqDB search
MRAYIVGNVAIDETIAVSELPVIGASILGNAGGSDLGGKGTNQAVVMARCGVPTTLVAPI
GRDARADTIRHYLADEPLRSELIEMENASSDVSIIFRLPGGENAIVTTTEAAQSLSLSDV
RRILSTAGPGDLMMLQGNLSDQTTRDILEHARAMGMVTAFNPSPVRSYFSDLWGLIDIAF
LNKGEAQTLTGTTGGQAAEYLLSRGLRDVVLTLGSDGAMLVNRHDSVEVPAQVCDVVDTT
GAGDTFMAAALASCVMRRQRLDRLAIEHAAAAAAITVSRHGTRKAFPTISELEAILR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcctacatagtcggtaacgtcgccatcgacgaaaccatcgccgtctccgaactt
cccgttatcggtgcctccatcctcggcaatgccggtggcagcgatctcggcggcaagggc
acgaaccaggcggtcgtcatggcccgctgcggcgttccgacaacgctggtggcgcccatc
ggcagggatgcgagggccgatacaatacgccattacctcgcggacgaaccgcttcggagc
gaactgatcgaaatggaaaatgcatcgagcgatgtctcgatcatcttccggctgccgggc
ggcgaaaatgccatcgtcacgacaacggaagcggcgcagagcctgtccctgtccgatgtc
aggcggatcctgtcgacggccggccctggcgatcttatgatgctgcagggcaatctgtcc
gaccagacgacccgcgatatcctggagcatgcaagagcgatgggcatggtcaccgccttc
aatccctcgccggtgcgctcttatttctctgatctttgggggttgatcgacatcgccttc
ctcaacaagggcgaggcgcagaccctgacgggaacgacgggcgggcaggctgccgaatat
ctgctaagccggggcctgcgagacgtcgttctgacgctcggcagcgacggcgcgatgctc
gtgaaccggcacgatagtgtcgaagtaccggcccaggtctgcgatgttgtggatacaacg
ggcgcaggcgataccttcatggccgcagcactggcatcctgcgtgatgcgcaggcagagg
ctggaccgtctagccatcgaacacgcagccgcggccgcggccatcaccgtctcaagacat
ggaacgagaaaggcgtttccgaccatttccgagcttgaagcgatcctgagatag

DBGET integrated database retrieval system