KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_6175Help
Entry
Rleg_6175         CDS       T00926                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Brite
Enzymes [BR:rlg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Rleg_6175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pR132504:219695..220579
Genome map
AA seq 294 aa AA seqDB search
MESVLPMTPDEMKIVRRAYAKQITAAARVADERVETAFAEVPREDFLGPGPWPIFRMRKA
YVPTPAADPVYLYTDDVVGIVPERHINNGQPSLHAFLLSQAAPRAGEHIVHVGAGAGYYS
AIMAKLVGASGKVTAIEFEPELAARAKANLAPYPNVSVVPGDGSSVAFDTADVIYVNAGA
TRPANIWLDRLNNGGRLILPLTTDLGFTSSNWSNMHLRGAVFLVMRRGEEFHAQWISPVA
IFPCEGMRDEESEKALAAAFESGEHKRVTRLYRTDEVPVERCWVRAPGWCLAYA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggttctgccgatgacacctgatgaaatgaagatcgtgcggcgagcttatgcg
aagcagatcacggcggctgcgagagttgccgatgagcgtgttgaaacagcttttgccgaa
gtgccgcgggaagatttccttggtcccggtccgtggccgatcttccgaatgcgaaaagcc
tatgttccgaccccggccgccgacccggtttacctctacacggatgacgttgttggtatc
gtccctgagcgccacatcaacaacggacaaccgtcacttcatgccttcctgctttcgcag
gctgcgccgcgagcgggcgagcatatcgtgcatgttggcgctggtgccggctactattct
gcgatcatggcgaaactcgttggcgcatccggcaaggtgacggcgatcgagttcgagccg
gagcttgccgcacgcgcgaaagcaaatctcgctccctatccgaatgtttccgtagttccg
ggcgatggcagttccgtggctttcgatacagccgatgtgatctatgtgaacgcgggcgcg
acccggcccgcgaatatctggctggaccggctcaataatggcggaaggctgatcctaccg
cttacgaccgatcttggatttaccagcagcaattggagcaacatgcaccttcgcggtgcg
gtgttcctcgtgatgcgcaggggtgaggaatttcacgcgcaatggatttcgccggtcgcc
atcttcccctgtgaaggaatgcgcgatgaggaatcggaaaaagcgctcgcggcggcgttc
gaaagcggggagcacaagcgggtgacccggctgtatcgtactgatgaggtgccggtcgag
cgatgttgggttcgcgctcccggctggtgcctagcctatgcttag

DBGET integrated database retrieval system