KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_6435Help
Entry
Rleg_6435         CDS       T00926                                 

Definition
formaldehyde dehydrogenase, glutathione-independent
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg_6435
  Energy metabolism
   00680 Methane metabolism
    Rleg_6435
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rleg_6435
Enzymes [BR:rlg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Rleg_6435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pR132505:153174..154364
Genome map
AA seq 396 aa AA seqDB search
MSKNRGVVYLRPGKVEVRDIDDPKLEAPDGRRIEHGVILKVISTNICGSDQHMVRGRTTA
MPGLVLGHEITGEIIEKGIDVEMLEIGDIVSVPFNVACGRCRCCKSQDTGVCLTVNPARA
GGAYGYVDMGGWIGGQARYVTIPYADFNLLKIPDRDKAMAKIRDLTMLSDILPTGFHGAV
RAGVGVGSTVYVAGAGPVGLAAAASARILGAAVVMIGDFNKDRLAHAAKVGFEPIDLSKS
DRLGDMIAQVVGTNEVDSAIDAVGFEARGHSGGEQPAIVLNQMMEITRAAGSIGIPGLYV
TEDPGAVDNAAKHGNLSLRFGLGWAKAQSFHTGQTPVIKYNRQLMQAILHDRLPIADIVN
AKVIPLDDAANGYESFDQGAATKYVLDPHGEVAKAA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaatagaggcgtcgtctatctccggccgggcaaggtcgaagttcgcgacatc
gacgacccgaagctggaagcgcctgacggccgccgcatcgaacacggcgtcattctgaaa
gtgatttctaccaatatctgcggctccgatcagcacatggtccgcggccgcacgacggcg
atgccgggcctggtccttggtcatgaaatcaccggcgagatcatcgagaaaggcatcgat
gtcgagatgctcgaaatcggcgatatcgtctcggtgcctttcaatgtcgcctgcggccgc
tgccgctgctgcaagtctcaggataccggtgtctgcctgacggtaaacccggcccgcgcc
ggcggtgcttatggttatgtcgacatgggcggctggatcggcggacaggcacgctacgtc
accattccctacgcagatttcaacctgctgaaaatccccgatcgggacaaggcaatggcg
aagatccgggatctcaccatgctctccgacatcctgcccaccggcttccatggcgcagtg
cgggcaggcgttggcgtcggctcgaccgtctatgtcgcaggcgcgggccccgtcggcctt
gcggctgccgcttcggctcgcattctcggcgccgcagtcgtgatgatcggtgacttcaac
aaagaccgtctggcgcatgcggcgaaggtcggtttcgaaccgatcgacctgtcgaagagc
gaccgtcttggcgacatgatcgcgcaggtcgtcggcaccaacgaagtggacagcgccatc
gatgctgtcggcttcgaggcccgcggccactcgggcggggaacagccggcgatcgtgctc
aatcagatgatggagattacccgtgccgccggttcgatcggcattcccggcctctacgtt
accgaggatccaggtgctgtcgacaatgccgccaaacacggcaatttgtcgcttcgcttc
ggcctcggatgggccaaggcgcagtccttccacaccggccagactccggtgatcaaatac
aatcgtcaactcatgcaggcgatcctccacgaccgactgccaattgccgatatcgtcaac
gccaaggtcatcccgctcgacgatgccgccaatggatatgagagcttcgaccagggagcg
gcgacgaaatatgtcctcgatccgcatggcgaggtggcgaaagccgcatag

DBGET integrated database retrieval system