KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_6435Help
Entry
Rleg_6435         CDS       T00926                                 

Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00625  Chloroalkane and chloroalkene degradation
rlg00680  Methane metabolism
rlg01100  Metabolic pathways
rlg01120  Microbial metabolism in diverse environments
rlg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Rleg_6435
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rleg_6435
Enzymes [BR:rlg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Rleg_6435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACS61185
JGI: Rleg_6435
UniProt: C6BAS7
Position
pR132505:153174..154364
Genome map
AA seq 396 aa AA seqDB search
MSKNRGVVYLRPGKVEVRDIDDPKLEAPDGRRIEHGVILKVISTNICGSDQHMVRGRTTA
MPGLVLGHEITGEIIEKGIDVEMLEIGDIVSVPFNVACGRCRCCKSQDTGVCLTVNPARA
GGAYGYVDMGGWIGGQARYVTIPYADFNLLKIPDRDKAMAKIRDLTMLSDILPTGFHGAV
RAGVGVGSTVYVAGAGPVGLAAAASARILGAAVVMIGDFNKDRLAHAAKVGFEPIDLSKS
DRLGDMIAQVVGTNEVDSAIDAVGFEARGHSGGEQPAIVLNQMMEITRAAGSIGIPGLYV
TEDPGAVDNAAKHGNLSLRFGLGWAKAQSFHTGQTPVIKYNRQLMQAILHDRLPIADIVN
AKVIPLDDAANGYESFDQGAATKYVLDPHGEVAKAA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaatagaggcgtcgtctatctccggccgggcaaggtcgaagttcgcgacatc
gacgacccgaagctggaagcgcctgacggccgccgcatcgaacacggcgtcattctgaaa
gtgatttctaccaatatctgcggctccgatcagcacatggtccgcggccgcacgacggcg
atgccgggcctggtccttggtcatgaaatcaccggcgagatcatcgagaaaggcatcgat
gtcgagatgctcgaaatcggcgatatcgtctcggtgcctttcaatgtcgcctgcggccgc
tgccgctgctgcaagtctcaggataccggtgtctgcctgacggtaaacccggcccgcgcc
ggcggtgcttatggttatgtcgacatgggcggctggatcggcggacaggcacgctacgtc
accattccctacgcagatttcaacctgctgaaaatccccgatcgggacaaggcaatggcg
aagatccgggatctcaccatgctctccgacatcctgcccaccggcttccatggcgcagtg
cgggcaggcgttggcgtcggctcgaccgtctatgtcgcaggcgcgggccccgtcggcctt
gcggctgccgcttcggctcgcattctcggcgccgcagtcgtgatgatcggtgacttcaac
aaagaccgtctggcgcatgcggcgaaggtcggtttcgaaccgatcgacctgtcgaagagc
gaccgtcttggcgacatgatcgcgcaggtcgtcggcaccaacgaagtggacagcgccatc
gatgctgtcggcttcgaggcccgcggccactcgggcggggaacagccggcgatcgtgctc
aatcagatgatggagattacccgtgccgccggttcgatcggcattcccggcctctacgtt
accgaggatccaggtgctgtcgacaatgccgccaaacacggcaatttgtcgcttcgcttc
ggcctcggatgggccaaggcgcagtccttccacaccggccagactccggtgatcaaatac
aatcgtcaactcatgcaggcgatcctccacgaccgactgccaattgccgatatcgtcaac
gccaaggtcatcccgctcgacgatgccgccaatggatatgagagcttcgaccagggagcg
gcgacgaaatatgtcctcgatccgcatggcgaggtggcgaaagccgcatag

DBGET integrated database retrieval system