KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_6848Help
Entry
Rleg_6848         CDS       T00926                                 

Definition
D-cysteine desulfhydrase
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pR132502:complement(292987..294015)
Genome map
AA seq 342 aa AA seqDB search
MSDWDLLNRFPRVRLVNGPTPIQRLDRLEQVLGESRRGVSIWAKRDDLMELGGGGNKLRK
LEFLIGQARSKGCDTLVVTGGVQSNFARLAAAACARTGLACEVVLTQTVPRGTEIYQANG
NVLLDRVFGARVHLLGTGDDATAFATARASEIAAAGGKAFVGTLGGSTPVGALGYVDCAF
EIAAQSTEIGIAFDHVVIPNGSGGMHAGLAVGDALVGKNPSRIRAYTVLSPAETCVAATV
EKVNAVFDLLGKKDRIRAEELAIDGAKLGGGYGVPTCEMIEAIRLVGRSEGLLLDPVYGG
KAFAGLLSDIENEVIAPGSNVLFVMTGGSPGLYAYADALSSD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactgggatcttttgaaccggtttccgcgcgtacgcctggtgaacggaccgacg
ccgatccagcggctggatcgtctggagcaagtgctcggcgagagccgacgaggcgtctcg
atctgggcgaagagagacgatctgatggaactcgggggcgggggcaacaagctccgcaag
cttgaattcctcatcgggcaggcccggtcgaaaggctgcgataccctcgtcgtaaccggc
ggcgtgcagtcaaatttcgcccgtctggccgcggccgcctgcgccagaaccggactggca
tgcgaggtcgttctgactcaaacggtgccccgcgggaccgagatctaccaggccaacggc
aacgtcttgttggaccgggtctttggcgcccgcgtccacctcctcggcaccggcgacgat
gcgaccgcgttcgccacggcccgcgcgtcggagatcgccgcggccggagggaaggctttc
gtgggcacgcttggcggttcgacgccggtcggagctctgggctacgtcgactgcgcattc
gaaatcgcagcgcaatcgactgagatcggcatcgcgttcgaccacgtcgtcatcccgaac
ggtagtggcggcatgcacgccggtctggccgtgggagatgccctggtcggaaaaaatcct
tccaggatcagagcatacaccgtgctctcgccagcggagacatgcgtcgccgcgacggtg
gagaaggtcaatgcggtcttcgacctcctcgggaagaaggaccgaattcgagctgaggag
ctggcgatagacggcgcgaagctcggtggcggctacggcgtgccgacgtgcgaaatgatt
gaagcgatcaggctcgtcggccgctctgaaggcctgcttctggatcccgtctacggaggg
aaagcctttgccggcctgctgtccgatatcgaaaacgaagtcatcgcgccaggatcgaac
gtcctgtttgtcatgacgggaggttctcctgggctttatgcctatgcagacgccctgagt
agcgactga

DBGET integrated database retrieval system