KEGG   Roseobacter litoralis Och 149: RLO149_c000620Help
Entry
RLO149_c000620    CDS       T01572                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rli00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rli00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
67123..67671
Genome map
AA seq 182 aa AA seqDB search
MRTSKRALAAVVSAVFAAGSVWAGARDHQFASIDGGYLEMADWAGQPVLVVNTASQCGFT
GQYAGLQKLYDTYRDAGLVVFAIPSDDFNQELGSAQEVKEFCEMNYGLDMPMADITRIRG
KNAHPFYQEVRAETGFVPRWNFNKVLIGLDGEVVETWGSQTKPMSREITETVEGLLEKAG
RG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaggacttcgaaaagagcattggcggcagtcgtatccgccgtatttgccgcaggctcg
gtttgggccggcgcacgtgatcaccagtttgcatccatcgacggcggttatctggaaatg
gccgattgggcgggacagcccgtgctggtcgtcaataccgcatcgcaatgtgggtttacg
ggccaatacgccgggctgcagaagctctacgacacctaccgcgacgcgggtcttgtggtt
ttcgcgattccatcagatgatttcaaccaagagcttggtagtgcacaggaggtcaaggag
ttctgcgagatgaactatggactggacatgccgatggcggacatcacgcgcatccggggt
aagaacgcacatccgttttatcaggaagtacgcgcggaaaccgggtttgtgccgcgctgg
aacttcaataaggttttgatcgggctggacggggaagtcgtggaaacctggggttcgcag
accaaaccgatgtcacgtgaaataaccgagacggttgaggggcttctggaaaaagcaggt
cgggggtga

DBGET integrated database retrieval system