KEGG   Roseobacter litoralis: RLO149_c000620Help
Entry
RLO149_c000620    CDS       T01572                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rli  Roseobacter litoralis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RLO149_c000620
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RLO149_c000620
Enzymes [BR:rli01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RLO149_c000620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
67123..67671
Genome map
AA seq 182 aa AA seqDB search
MRTSKRALAAVVSAVFAAGSVWAGARDHQFASIDGGYLEMADWAGQPVLVVNTASQCGFT
GQYAGLQKLYDTYRDAGLVVFAIPSDDFNQELGSAQEVKEFCEMNYGLDMPMADITRIRG
KNAHPFYQEVRAETGFVPRWNFNKVLIGLDGEVVETWGSQTKPMSREITETVEGLLEKAG
RG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaggacttcgaaaagagcattggcggcagtcgtatccgccgtatttgccgcaggctcg
gtttgggccggcgcacgtgatcaccagtttgcatccatcgacggcggttatctggaaatg
gccgattgggcgggacagcccgtgctggtcgtcaataccgcatcgcaatgtgggtttacg
ggccaatacgccgggctgcagaagctctacgacacctaccgcgacgcgggtcttgtggtt
ttcgcgattccatcagatgatttcaaccaagagcttggtagtgcacaggaggtcaaggag
ttctgcgagatgaactatggactggacatgccgatggcggacatcacgcgcatccggggt
aagaacgcacatccgttttatcaggaagtacgcgcggaaaccgggtttgtgccgcgctgg
aacttcaataaggttttgatcgggctggacggggaagtcgtggaaacctggggttcgcag
accaaaccgatgtcacgtgaaataaccgagacggttgaggggcttctggaaaaagcaggt
cgggggtga

DBGET integrated database retrieval system