KEGG   Roseobacter litoralis: RLO149_c002680Help
Entry
RLO149_c002680    CDS       T01572                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase MurA (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
rli  Roseobacter litoralis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RLO149_c002680 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RLO149_c002680 (murA)
Enzymes [BR:rli01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     RLO149_c002680 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
265795..267063
Genome map
AA seq 422 aa AA seqDB search
MDSILVKGGGSLKGQIPIAGAKNACLALMPATLLSEEPLTLTNAPRLSDIRTMTQLLQSL
GAEVTSLQDGKVLAMSCHGAINTRAEYDIVRKMRASNLVLGPLLAREGHAQVSLPGGCAI
GARPMDIHTDGLSQMGAEIELKDGYLLAKAKGGRLKGAVIDFPFASVGATENIVMAASLA
KGTTVINNAAREPEIVDLVECLRAMGAQIEGEGTSTISVQGVDRLGGTTHRVVTDRIELG
TYMLAPAICGGQVELLGGRINLLAAFCDKLDAAGVTVTETANGLSVARANGDIRAVDVTT
EPFPGFPTDLQAQMMALLCTAKGTSVLEEKIFENRFMHAPELIRMGADIEVHGGTATVKG
VDRLKGAPVMATDLRASVSLILAGLAAEGETKVSRVYHLDRGYEHVVRKLSAVGAQIERI
AE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggattcgatattggtaaaagggggcggcagcctgaaggggcagatcccgatcgcaggt
gcaaagaacgcctgccttgccctcatgcccgcaacattgttgtccgaagaaccactgacg
ctgaccaatgcaccgcgcttgtcggacatccgcacaatgacgcaactgcttcagtcgctg
ggggcggaagtgacctcgctgcaggatggtaaggtgctggcgatgtcctgtcacggggcg
atcaacacccgtgcggaatatgacatcgtgcgcaagatgcgcgcgtccaacctcgtgctt
gggccgcttttggcgcgcgaaggtcacgcgcaggtttccctgcccgggggatgtgcaatc
ggggcacgccccatggacatccacaccgacgggttgagccagatgggcgccgagatcgag
ttgaaagacggctatctgctggccaaggccaagggcggacggctcaagggggcggtcatt
gactttccctttgcctctgttggggcgaccgagaatatcgtgatggccgcgtcactggcg
aaaggcaccaccgtcattaacaatgccgcgcgcgagcccgagattgtggatcttgttgaa
tgcctgcgcgccatgggagcacaaatcgaaggcgaagggacctcgactatctcggtgcag
ggcgttgaccgactgggcggcaccacccaccgcgttgtgacggaccggattgagcttggc
acctatatgctcgccccggcgatctgcggcggacaggtggaactgctggggggacgcatc
aacctgctggctgcgttttgtgacaagctggatgcggcgggtgtcacggtgaccgaaact
gcgaatgggttgagtgtcgcccgcgcaaatggggatatccgcgcggtcgatgtcacgacg
gagccatttccggggtttcccaccgatctgcaggcgcagatgatggccctgttgtgcacc
gccaaagggacctctgttctggaagaaaagatattcgagaaccggttcatgcatgcgcct
gagctcattcgcatgggcgctgacatcgaggtgcatggcgggaccgcgacagtcaagggg
gttgaccgcctgaagggggccccggtgatggccaccgatctgcgggcgtccgtttccctg
atccttgcggggcttgccgctgagggcgagacaaaagtgtcccgcgtctatcatctcgac
cgtggatatgagcatgtggtgcgcaagctctccgctgttggggcgcagatcgaaaggatc
gcggaataa

DBGET integrated database retrieval system