KEGG   Roseobacter litoralis Och 149: RLO149_c002700Help
Entry
RLO149_c002700    CDS       T01572                                 

Gene name
hisD1
Definition
histidinol dehydrogenase HisD (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rli01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:rli00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
267576..268889
Genome map
AA seq 437 aa AA seqDB search
MPVFLNAADPDFETRFSALLSAKREDSPDVDATVAQIIADVRARGDAALIDLTEKFDRLT
LTPDRLAITPDEVDAAVATAPGDQVAALELAAQRIRAYHERQRPEDAEWIDDSGAMLGWR
WTPVAAAGLYVPGGLASYPSSVLMNAIPAKVAGVSRLAMVVPAPDGVLNPLVLAAARLSG
VDEIYRIGGAQAVAALAYGTATIAPVDKITGPGNAFVAAAKRRVFGKVGIDMIAGPSEIL
VIADAQNDPDWIALDLLSQAEHDESAQSILITTDAAFGRAVAVAVEKRLETLERRAIAGA
SWRDFGAIVTVPDLATAATLSDRIAPEHLELCVADPDALSAQITHAGAIFLGQWTPEAIG
DYVGGPNHVLPTARSARFSSGLSVLDFMKRTTLARMTPAALRAVGPAAETLANSESLEAH
GLSVTARLRKLNDSEAL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtatttctgaatgctgccgatccagattttgagacccgcttcagcgctttgctg
agcgccaagcgcgaagacagccccgatgtagacgccaccgttgcgcaaatcattgcggat
gtccgagcacgcggtgacgcggccctgatcgacctgacggaaaagtttgaccggctgacg
ttgacgccggatcgcctcgccatcacgcctgatgaggtggatgctgcggttgcgacggcg
cccggcgatcaggtggccgcactggaactggcggcgcaacgtatccgcgcctaccatgaa
cgccaacgtcctgaggacgcagagtggatcgatgacagcggcgcaatgctgggctggcgc
tggacgcctgtggcggcagctgggctttatgtgccgggtggtcttgcgtcctacccgtcc
tcggtgctgatgaacgccatccctgccaaggtcgcgggggtttcccgccttgccatggtc
gtgccggcacctgatggcgtgctgaacccgcttgtgctggccgcagcacgtctgtcgggg
gttgatgaaatctaccgtatcgggggggcacaggccgtggcagcacttgcctacggcacg
gcgacaatcgcgccggtggataagatcaccggtccgggcaatgcctttgtcgcggcggcc
aagcggcgtgtttttggcaaagtcggcattgatatgattgcgggtccatccgaaatactg
gtgattgcagatgcgcagaatgacccggattggatcgccctcgatttgctgagccaggcg
gaacatgacgaaagcgcgcagtctatcttgatcacgaccgatgctgcgttcgggcgggcg
gtggcggtggcggttgaaaagcggttggaaaccctagagcggcgcgcgatcgcgggtgcg
tcctggcgcgattttggggcgatcgtcacagtccctgatctggccacagcggctacattg
tccgaccggatcgcccctgaacatcttgagctttgcgtggcggacccggatgccctgagc
gcgcagatcacgcatgccggggcgatttttctggggcaatggacgccagaggcgattggc
gattatgtcgggggacccaatcatgttctgccaacggcacgctctgcccggttctcatcg
ggcctgtccgtgcttgatttcatgaagcgtacgacactggcgcggatgacaccggcggca
ttgcgcgccgtcggtccggcggccgagacgctggccaactcggaaagccttgaggcgcac
ggcctttctgtgacggcgcgcctgcgcaaactaaacgacagtgaagcgctctaa

DBGET integrated database retrieval system