KEGG   Roseobacter litoralis: RLO149_c004580Help
Entry
RLO149_c004580    CDS       T01572                                 

Gene name
deoA
Definition
thymidine phosphorylase DeoA (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rli  Roseobacter litoralis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RLO149_c004580 (deoA)
Enzymes [BR:rli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RLO149_c004580 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
485753..487063
Genome map
AA seq 436 aa AA seqDB search
MADARSVLARLRHGSALTTTDMKWVAQALADHGMSDAQAGAFAMGVCARGLRDPERVALT
LAMRDSGKVLRWDLPGPILDKHSTGGVGDCISLVLAPALAACGAYVPMISGRGLGHTGGT
LDKLEAIPGLVTQLDEDRFRAVVSEAGCAIVGANADIAPADRRLYAVRDVTSTVDSLDLI
TASILSKKLAAGLEGLVLDVKIGSGAFMKDKKAAQALAHALVTTANAAECKTTALISDMS
QPLAPSLGNALEVAEVMRVLTGAADGPLVELSVALGGVLLANAGSANDVQAGADAIRAAI
KEGRAATQFGRMVAAMGGPVHFVENWQRFLPEATVIREVSALQSGHIAAIDGEALGLAVV
SLGGGRRVETDKIDPRVGLTQVVRLGAKVRKGQPLAVVHASRPDDADRAVAAVRAAISLS
ESDTIAVPDLIHERVG
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgcacgttctgtccttgcgcgcctgcgtcatggttcggccctcaccacgaca
gatatgaaatgggttgcgcaagcgcttgcggatcacgggatgagtgatgcgcaggccggt
gcctttgccatgggcgtttgtgcgcgtggtttgcgtgatcctgagcgggtcgcgctgacg
ctggcgatgcgtgacagtggcaaggtgttgcggtgggatctgccggggccgatactcgac
aaacactcaacgggtggcgtgggcgattgcatctccttggtgcttgcgcccgctctggcg
gcctgcggggcctatgtgccgatgatttcgggtcgcggccttggccataccggcggaaca
ctagataagctggaggcgataccgggtcttgtcacgcaactggacgaggaccggtttcgc
gccgtcgtttcagaagcaggctgcgcgatcgtgggggccaacgctgatatcgccccggcg
gatcgcaggctttatgcggtgcgggatgtgacctcgacggttgatagtcttgatctgatc
accgcatccatcctgtccaagaaactcgccgcaggccttgaggggctggtgcttgatgtc
aagatcggcagtggcgcattcatgaaggataaaaaggcggcacaggcactggcgcacgca
ttggtcacaacggcgaatgctgcggagtgcaaaaccactgcgctgatcagcgacatgagc
caaccgctcgcgccgagccttggcaatgcgcttgaggtggccgaagtcatgcgcgttctg
acaggtgctgctgatgggccgctggttgaactatcggtcgcgctgggcggggtgctgttg
gccaatgcggggtccgccaatgacgtacaggccggggccgatgccatccgtgccgcgatc
aaagaggggcgcgccgcgacccagttcgggcggatggttgccgccatgggagggccggtg
catttcgtggagaactggcaacgtttcctacccgaagcgaccgtgatccgcgaggtttcc
gccctgcaatcgggccatatcgctgcgattgacggcgaagccctggggctggccgttgtc
agccttggcggtggtcggcgcgttgagacggacaagatcgacccccgcgtcggtctgaca
caggtggtgcggcttggggccaaggttcgcaagggtcagcctttggcggttgtgcatgcc
agccgacccgacgatgcggatcgcgcggttgctgcagtgcgcgctgcgatctccctctcg
gagagtgacacaatcgctgtgcctgacctgatacatgaaagggttggatga

DBGET integrated database retrieval system