KEGG   Roseobacter litoralis: RLO149_c004640Help
Entry
RLO149_c004640    CDS       T01572                                 

Gene name
fadJ
Definition
(GenBank) fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rli  Roseobacter litoralis
Pathway
rli00071  Fatty acid degradation
rli00280  Valine, leucine and isoleucine degradation
rli00281  Geraniol degradation
rli00310  Lysine degradation
rli00362  Benzoate degradation
rli00380  Tryptophan metabolism
rli00410  beta-Alanine metabolism
rli00640  Propanoate metabolism
rli00650  Butanoate metabolism
rli00903  Limonene and pinene degradation
rli00930  Caprolactam degradation
rli01040  Biosynthesis of unsaturated fatty acids
rli01100  Metabolic pathways
rli01110  Biosynthesis of secondary metabolites
rli01120  Microbial metabolism in diverse environments
rli01130  Biosynthesis of antibiotics
rli01200  Carbon metabolism
rli01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RLO149_c004640 (fadJ)
   00650 Butanoate metabolism
    RLO149_c004640 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    RLO149_c004640 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    RLO149_c004640 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RLO149_c004640 (fadJ)
   00310 Lysine degradation
    RLO149_c004640 (fadJ)
   00380 Tryptophan metabolism
    RLO149_c004640 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RLO149_c004640 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RLO149_c004640 (fadJ)
   00281 Geraniol degradation
    RLO149_c004640 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RLO149_c004640 (fadJ)
   00930 Caprolactam degradation
    RLO149_c004640 (fadJ)
Enzymes [BR:rli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RLO149_c004640 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RLO149_c004640 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RLO149_c004640 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 UDPG_MGDP_dh_N F420_oxidored FAD_binding_3 Pyr_redox_2 Asparaginase 2-Hacid_dh_C ApbA
Motif
Other DBs
NCBI-ProteinID: AEI92492
UniProt: F7ZIH3
Position
complement(492530..494728)
Genome map
AA seq 732 aa AA seqDB search
MTDFTMDTDAAGIATITWDVKDKSMNVMTLEAWDVLDALIDQALTDDAIKGVVITSGKDS
FAGGMDLNVIARMKEMAGDDPAKGLFDGIMNAHRIMRKIERAGIDPKTLKGGKPIATVLP
GTALGIGLEIPLCTHRIFAAPNPKAKIGLPEIMVGIFPGAGGTTRLTRKMGAMAASPFLL
EGKLVDPARAKAAGLIDEVADDPMAAARDWVLNAKDADLVKPWDAKGYKMPGGAPYHPAG
FMTFVGASAMVNGKTQGVYPAAKALLSAVYEGALVPFDTALKVEARWFTNVLMNPSSSAM
IRSLFVNKEALEKGAVRPDDVADQRVKKLGVLGAGMMGAGISLVSAQAGIEVVLIDQTQE
AADRGKAYTASFADKGIARKKTTPEKKEQLLNLITATTDLDHLKDCDLIIEAVFEDPKVK
AEMTRKVEAVIPQDCIFASNTSTLPITELAKASSRPDQFIGIHFFSPVEKMLLVEIIKGK
GTGDRAVAKALDYVRQIRKTPIVVNDARFFYANRCIIPYINEGIRMVAEGVEPALIENAA
KLVGMPLGPLQLVDETSIDLGAKIARATKAAMGDAYPDAAVDEVIFWMEGENRLGRKTSA
GFYAYDEKGKRQGLWDGLAAQYPVSDTQPDLIDVQHRLLFSQTLEAVRALEEGVLMDIRE
GDVGAILGWGFAPWSGGPVSWLDMLGAAYAAERCDQLTQSFGDRFTCPDLLRDMAAKNQS
FYGRFAQKPKAA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgactgattttacaatggacacggatgccgcaggcattgcgaccatcacatgggacgtc
aaagataaatccatgaacgtcatgacgcttgaggcatgggatgtgctcgacgctttgata
gaccaggcgctgacggatgacgcaatcaagggcgtggtcatcacctcgggcaaagacagc
tttgccggtgggatggacctcaacgtgattgcacgcatgaaagagatggcaggcgatgac
ccggcaaaaggtttgtttgacgggatcatgaacgcccatcgcatcatgcgaaaaatcgaa
cgcgctggcatagaccccaagaccctgaaaggtggcaagcccattgccactgtgctgccc
ggtacagcccttggcatcgggcttgaaatcccgctgtgcacgcatcgcatctttgccgca
cccaaccccaaggccaagatcggcctgcccgagatcatggtcggtatctttcccggcgcc
ggtggcacgacccgcctgacgcgcaagatgggggcgatggccgcatcgccgttcctgctg
gaagggaaactggttgaccctgcgcgcgccaaagccgccgggttgatcgacgaagtggcg
gatgatccgatggccgctgcccgcgactgggtgttgaatgccaaggacgcggacctcgtc
aaaccatgggatgccaagggatacaagatgcccggcggcgcgccctatcatccggcgggt
ttcatgacttttgtcggggcctctgcgatggtgaacggcaagacgcaaggggtgtatccg
gcggccaaggcgttgttgtcagccgtctatgaaggcgcgcttgtgccgttcgacaccgcc
ctcaaagtagaagcccgttggttcacgaatgtgctcatgaacccatcgtcatccgcgatg
atccgttcgcttttcgtcaacaaggaagcgcttgagaaaggggcggtgcgtccggatgat
gttgcagatcaacgggttaaaaagctcggcgtgctgggcgcgggcatgatgggggctggt
atctcgctggtctctgcgcaggccgggattgaggtcgtgctgattgaccagacgcaagag
gccgcagatcgtggcaaggcctataccgccagctttgccgacaaaggcattgcgcgcaaa
aagacaacgcctgaaaagaaagaacaactgctcaacctgatcacggcgaccactgacctt
gaccacctcaaggactgtgatctgatcatcgaagccgtgttcgaagatccgaaagtcaaa
gccgaaatgacccggaaggtcgaggccgtgatcccgcaggactgtattttcgcctccaac
acctcgaccctgccgatcaccgaactggccaaagcctcatcgcgcccggatcagttcatt
ggcatccacttcttctcgcccgtcgagaaaatgctgctggtggagatcatcaagggcaag
ggtacgggcgaccgggccgtggccaaggcgttggattacgtgcgccagattcgcaaaacg
cccatcgttgtgaatgacgcgcggttcttttatgccaaccgctgcatcattccctacatc
aacgaaggcatccgcatggtcgccgagggggttgaacctgcgctgatcgaaaacgcggcc
aaactggtcggcatgccgcttggtccgctgcaactggttgatgaaacctcgattgatctg
ggcgctaaaatcgcgcgtgctaccaaggctgccatgggcgatgcctatcccgatgcggcg
gtggacgaggtgatcttctggatggagggcgaaaaccgtctgggccgcaagaccagtgcc
gggttttacgcctacgacgaaaaggggaaacgtcagggtctatgggacggtcttgccgcg
caatatcctgtatctgatacgcagcccgacctgattgacgtgcagcatcgcctgttgttt
tcgcaaacgctcgaagcggtgcgcgcgctcgaagagggcgtgttgatggacatccgcgaa
ggggacgtgggcgcgatcctcggctggggctttgcgccttggtccggcggcccggtcagc
tggctcgacatgctgggcgcggcctatgccgctgagcggtgcgatcaattgacacaaagc
ttcggagatcgtttcacctgccccgatcttttgcgcgacatggccgcgaaaaaccaaagc
ttctatggccggttcgctcagaaacccaaagctgcctga

DBGET integrated database retrieval system