KEGG   Roseobacter litoralis: RLO149_c004640Help
Entry
RLO149_c004640    CDS       T01572                                 

Gene name
fadJ
Definition
fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rli  Roseobacter litoralis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RLO149_c004640 (fadJ)
   01212 Fatty acid metabolism
    RLO149_c004640 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RLO149_c004640 (fadJ)
   00650 Butanoate metabolism
    RLO149_c004640 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    RLO149_c004640 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    RLO149_c004640 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RLO149_c004640 (fadJ)
   00310 Lysine degradation
    RLO149_c004640 (fadJ)
   00380 Tryptophan metabolism
    RLO149_c004640 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RLO149_c004640 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RLO149_c004640 (fadJ)
   00281 Geraniol degradation
    RLO149_c004640 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RLO149_c004640 (fadJ)
Enzymes [BR:rli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RLO149_c004640 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RLO149_c004640 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RLO149_c004640 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(492530..494728)
Genome map
AA seq 732 aa AA seqDB search
MTDFTMDTDAAGIATITWDVKDKSMNVMTLEAWDVLDALIDQALTDDAIKGVVITSGKDS
FAGGMDLNVIARMKEMAGDDPAKGLFDGIMNAHRIMRKIERAGIDPKTLKGGKPIATVLP
GTALGIGLEIPLCTHRIFAAPNPKAKIGLPEIMVGIFPGAGGTTRLTRKMGAMAASPFLL
EGKLVDPARAKAAGLIDEVADDPMAAARDWVLNAKDADLVKPWDAKGYKMPGGAPYHPAG
FMTFVGASAMVNGKTQGVYPAAKALLSAVYEGALVPFDTALKVEARWFTNVLMNPSSSAM
IRSLFVNKEALEKGAVRPDDVADQRVKKLGVLGAGMMGAGISLVSAQAGIEVVLIDQTQE
AADRGKAYTASFADKGIARKKTTPEKKEQLLNLITATTDLDHLKDCDLIIEAVFEDPKVK
AEMTRKVEAVIPQDCIFASNTSTLPITELAKASSRPDQFIGIHFFSPVEKMLLVEIIKGK
GTGDRAVAKALDYVRQIRKTPIVVNDARFFYANRCIIPYINEGIRMVAEGVEPALIENAA
KLVGMPLGPLQLVDETSIDLGAKIARATKAAMGDAYPDAAVDEVIFWMEGENRLGRKTSA
GFYAYDEKGKRQGLWDGLAAQYPVSDTQPDLIDVQHRLLFSQTLEAVRALEEGVLMDIRE
GDVGAILGWGFAPWSGGPVSWLDMLGAAYAAERCDQLTQSFGDRFTCPDLLRDMAAKNQS
FYGRFAQKPKAA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgactgattttacaatggacacggatgccgcaggcattgcgaccatcacatgggacgtc
aaagataaatccatgaacgtcatgacgcttgaggcatgggatgtgctcgacgctttgata
gaccaggcgctgacggatgacgcaatcaagggcgtggtcatcacctcgggcaaagacagc
tttgccggtgggatggacctcaacgtgattgcacgcatgaaagagatggcaggcgatgac
ccggcaaaaggtttgtttgacgggatcatgaacgcccatcgcatcatgcgaaaaatcgaa
cgcgctggcatagaccccaagaccctgaaaggtggcaagcccattgccactgtgctgccc
ggtacagcccttggcatcgggcttgaaatcccgctgtgcacgcatcgcatctttgccgca
cccaaccccaaggccaagatcggcctgcccgagatcatggtcggtatctttcccggcgcc
ggtggcacgacccgcctgacgcgcaagatgggggcgatggccgcatcgccgttcctgctg
gaagggaaactggttgaccctgcgcgcgccaaagccgccgggttgatcgacgaagtggcg
gatgatccgatggccgctgcccgcgactgggtgttgaatgccaaggacgcggacctcgtc
aaaccatgggatgccaagggatacaagatgcccggcggcgcgccctatcatccggcgggt
ttcatgacttttgtcggggcctctgcgatggtgaacggcaagacgcaaggggtgtatccg
gcggccaaggcgttgttgtcagccgtctatgaaggcgcgcttgtgccgttcgacaccgcc
ctcaaagtagaagcccgttggttcacgaatgtgctcatgaacccatcgtcatccgcgatg
atccgttcgcttttcgtcaacaaggaagcgcttgagaaaggggcggtgcgtccggatgat
gttgcagatcaacgggttaaaaagctcggcgtgctgggcgcgggcatgatgggggctggt
atctcgctggtctctgcgcaggccgggattgaggtcgtgctgattgaccagacgcaagag
gccgcagatcgtggcaaggcctataccgccagctttgccgacaaaggcattgcgcgcaaa
aagacaacgcctgaaaagaaagaacaactgctcaacctgatcacggcgaccactgacctt
gaccacctcaaggactgtgatctgatcatcgaagccgtgttcgaagatccgaaagtcaaa
gccgaaatgacccggaaggtcgaggccgtgatcccgcaggactgtattttcgcctccaac
acctcgaccctgccgatcaccgaactggccaaagcctcatcgcgcccggatcagttcatt
ggcatccacttcttctcgcccgtcgagaaaatgctgctggtggagatcatcaagggcaag
ggtacgggcgaccgggccgtggccaaggcgttggattacgtgcgccagattcgcaaaacg
cccatcgttgtgaatgacgcgcggttcttttatgccaaccgctgcatcattccctacatc
aacgaaggcatccgcatggtcgccgagggggttgaacctgcgctgatcgaaaacgcggcc
aaactggtcggcatgccgcttggtccgctgcaactggttgatgaaacctcgattgatctg
ggcgctaaaatcgcgcgtgctaccaaggctgccatgggcgatgcctatcccgatgcggcg
gtggacgaggtgatcttctggatggagggcgaaaaccgtctgggccgcaagaccagtgcc
gggttttacgcctacgacgaaaaggggaaacgtcagggtctatgggacggtcttgccgcg
caatatcctgtatctgatacgcagcccgacctgattgacgtgcagcatcgcctgttgttt
tcgcaaacgctcgaagcggtgcgcgcgctcgaagagggcgtgttgatggacatccgcgaa
ggggacgtgggcgcgatcctcggctggggctttgcgccttggtccggcggcccggtcagc
tggctcgacatgctgggcgcggcctatgccgctgagcggtgcgatcaattgacacaaagc
ttcggagatcgtttcacctgccccgatcttttgcgcgacatggccgcgaaaaaccaaagc
ttctatggccggttcgctcagaaacccaaagctgcctga

DBGET integrated database retrieval system