KEGG   Roseobacter litoralis: RLO149_c005260Help
Entry
RLO149_c005260    CDS       T01572                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rli  Roseobacter litoralis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RLO149_c005260 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RLO149_c005260 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RLO149_c005260 (trpB)
Enzymes [BR:rli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RLO149_c005260 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
553150..554382
Genome map
AA seq 410 aa AA seqDB search
MANDLFNSFMTGPDENGRFGDFGGRFVSETLMPLILELEEQYENAKTDDSFWAEMHDLWT
HYVGRPSPLYYAERLTEHLGGAKVYMKRDELNHTGAHKINNVLGQIILARRMGKTRIIAE
TGAGQHGVATATVCAKFGLKCIVYMGAHDVERQAPNVFRMRLLGAEVVPVTSGRGTLKDA
MNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQAIIGKEVREQMTAAEGRFPDTLIA
AIGGGSNAMGLFYPFLDDKEVGIIGVEAGGKGVNAKMEHCASLTGGRPGVLHGNRTYLLQ
DDDGQILEGFSISAGLDYPGIGPEHAWLHDIGRAQYVSITDVEALEAFQLCCELEGIIPA
LEPSHALAHVMKIAPELPSDHIICMNMCGRGDKDIFTVAKALGFEMGEFA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgatcttttcaattctttcatgacgggtccggatgaaaacgggcgtttcggt
gatttcgggggacgttttgtctcagaaacgctgatgccgctgattctcgagttggaagag
caatacgaaaacgccaagacggatgacagcttctgggctgaaatgcatgacctctggacg
cattatgtcggccgtcccagcccgctttattatgctgaacgcctgacggagcatctgggt
ggtgccaaagtctatatgaaacgtgatgagttgaatcacacaggcgcccataagatcaac
aacgtgctgggccagatcattctggcgcgccgcatgggcaaaacgcggatcattgcggaa
acgggcgcgggtcagcacggtgtggcgacagcgacagtttgcgcaaaattcggtctcaaa
tgcatcgtgtatatgggcgcacatgacgttgagcgtcaggccccgaatgtgttccgcatg
cgacttctgggggccgaggttgtccccgtgacctcgggtcggggcacattgaaggatgcg
atgaacgacgccttgcgcgactgggtgaccaatgtccgcgacacgttctattgcattggc
actgttgccggcccgcacccttaccccgccatggtgcgggatttccaagcgatcatcggc
aaggaagtgcgtgagcaaatgactgccgccgaaggccggttcccggatacattgatcgcg
gcgattggcggtgggtcgaacgccatgggtctgttctatccgtttctggacgacaaggag
gttggcatcatcggcgtcgaagcaggcggcaaaggtgtaaatgccaagatggagcattgc
gcatcgctgacaggcgggcgacccggcgttctgcatggcaaccggacgtatctgttgcag
gatgacgacggtcagatcctcgaagggttctcaatttcagcgggcctcgattatccgggg
atcgggccggaacatgcatggctgcatgacatcgggcgcgcgcaatatgtgtcgatcaca
gatgtcgaagcgcttgaggcgttccaattatgctgcgaactggaaggtattattcccgcg
ctggaacccagtcatgcgctggcccatgtgatgaaaatcgcacctgaattgccgtcggat
cacataatctgcatgaacatgtgcgggcgtggcgacaaggatatctttaccgtcgccaaa
gcgctggggttcgagatgggcgaatttgcttaa

DBGET integrated database retrieval system