KEGG   Roseobacter litoralis Och 149: RLO149_c005980Help
Entry
RLO149_c005980    CDS       T01572                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rli00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
624316..626208
Genome map
AA seq 630 aa AA seqDB search
MHSFVLRIPLAGSASAPPVEHARLARLQDQGWRLTQTMAGVDGATTGDAGYCEAADWGAC
GLAFLQDRDGVTHQLDMSPQQAAEKSDLELLLDLRLAKGQDFIHTVYGSFSLVFIHKETG
RFEAYRDHLGVYPLYYTVSDGAVTCASDLRACLHLSGVALSADAIRIADFIKGDEVDFDR
TAFDAVLRLPPAHQLEPANQTVSPRRYWKLEIPQETVSTDCAEQLRDALQAATLACMRPE
GSVGAMLSGGLDSSALAGLAAKQSGAPVQTVSFVYGADKAYDETRYIDAANETFGSIPHK
IAIAGAPPLDDLATVLDEQMDLFLAPGLPKARQIYPHARALGLSAVIDGHGGDEVISHGY
GRLVELATHRKFSLLYREARGAAKVHSLPFLALFSSHIAHYSGMGPRNPLRRLFLKLARY
QTKRSSISGWSGTPISLITSDLQERIAATERYAPDPLLKTKADFNRAECLTHLRALNAPL
MAQAFEVFHRSATAAEVLPRYPFFDRRVLSLCLAFPAEMKLRDGRSRWILREAMRDILPE
SIRTRADKAEFGDEIFDVVRDFYSDKQVSFFEPMSDFVSVDAAEQLRKQVIVREVTDVAA
IRALWRLAVLSYWIKGLKGWCDAQAKGILI
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgtttgtcttgcggataccccttgctggatccgcgtccgctcctccggttgag
catgcgcgtctggcgcgcctgcaggatcagggatggcgtctgacgcagaccatggctggt
gtcgatggtgccacgacaggggatgcagggtattgtgaggctgcggactggggtgcatgt
ggccttgcgtttctgcaggaccgtgatggcgtcactcatcagcttgatatgtccccacag
caggctgctgaaaagtctgatctggaactgttgctcgatttgcgcttggccaagggtcag
gatttcatacacaccgtttacggttcgttttcacttgttttcatccacaaggaaaccggt
cgttttgaggcataccgagaccacttgggcgtttacccgctttattatacggtctcggat
ggcgcggtgacatgtgcgtcggatctgcgcgcatgtctgcatttgtctggtgtcgcatta
agcgccgatgctattcggattgcggatttcatcaagggcgatgaagttgattttgacagg
acagcctttgatgctgtgctgcggctaccgccggcacatcagcttgagcctgcaaaccaa
accgtgtcgccccggcggtattggaaattggagataccgcaagaaaccgtgagcacagat
tgcgccgagcaattgcgtgacgcgctgcaagcggcgacccttgcatgtatgcgccccgaa
gggagcgttggcgcgatgctgagcgggggattggattcctcggcgcttgccgggcttgcc
gcaaaacagtcgggcgctcctgtgcaaacggtgtcctttgtttatggcgcagacaaggcg
tatgatgaaacgcgctatatcgatgcggcgaatgagacattcgggagcatcccgcacaaa
atagcgattgcgggcgcaccgccgctggatgaccttgccacggtccttgatgaacagatg
gatttgtttctggcaccgggcctgcccaaagcacggcaaatctatccccatgcacgtgcc
ttgggattaagcgccgtgatcgatgggcacggcggggatgaggtcatttcgcatggctac
ggtcgtttggtcgaactggcgacacatcgaaaattctcgctgctttatcgcgaagcacgc
ggtgcggcgaaggtccatagtctcccgtttctcgcccttttttccagccatattgcccac
tacagcggaatgggaccaagaaacccgctgcgcaggctgttcctcaagctggcgcgctat
cagacaaagcgttcgtcgatatccggatggtcaggaacgccaatctcgctgatcacgtcg
gatctgcaggaacgaattgccgcaactgagagatatgcacccgacccacttttgaaaacc
aaggcggatttcaatcgagccgaatgcctgacgcatttaagggcactgaatgcccctttg
atggcgcaggcgtttgaagttttccaccgctccgccactgccgcagaggtgttgcccaga
tacccgtttttcgaccgtcgcgttttatctctgtgccttgcctttcccgctgaaatgaaa
ctgcgcgatggccgcagcaggtggattttgcgtgaagcgatgcgtgatattctgcccgag
agtattcgaacacgggcagataaagcggaatttggagacgaaatttttgatgtggtgcgc
gatttttacagtgacaaacaagtcagctttttcgagccaatgagcgatttcgtcagtgtt
gatgccgctgagcaattgcgcaaacaagtaattgtgcgtgaagtcacagacgtggctgca
attcgagcgttgtggcgactggctgttctaagctattggattaaagggcttaaggggtgg
tgtgacgcacaggctaaagggatattgatttga

DBGET integrated database retrieval system