KEGG   Roseobacter litoralis: RLO149_c006680Help
Entry
RLO149_c006680    CDS       T01572                                 

Gene name
glk
Definition
(GenBank) glucokinase Glk
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rli  Roseobacter litoralis
Pathway
rli00010  Glycolysis / Gluconeogenesis
rli00052  Galactose metabolism
rli00500  Starch and sucrose metabolism
rli00520  Amino sugar and nucleotide sugar metabolism
rli00521  Streptomycin biosynthesis
rli01100  Metabolic pathways
rli01110  Biosynthesis of secondary metabolites
rli01120  Microbial metabolism in diverse environments
rli01130  Biosynthesis of antibiotics
rli01200  Carbon metabolism
Module
rli_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RLO149_c006680 (glk)
   00052 Galactose metabolism
    RLO149_c006680 (glk)
   00500 Starch and sucrose metabolism
    RLO149_c006680 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RLO149_c006680 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RLO149_c006680 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RLO149_c006680 (glk)
Enzymes [BR:rli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RLO149_c006680 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK Pan_kinase
Motif
Other DBs
NCBI-ProteinID: AEI92696
UniProt: F7ZKN0
Position
693553..694527
Genome map
AA seq 324 aa AA seqDB search
MPHPSQKYSLVADIGGTNTRVALCDGVDVLNPTIRRYRNAENDGFTSVLAQYLAAEGNVR
PKAVCVAIAGPVNGGKGRLTNLDWDMDAEEIAKATGAAHVALLNDLQAQGYALDQLASDD
LACVRQGSATAKGNARLVVNLGTGFNASPVFMTQAGAYVATSESGHANMPIRTDQDLRLC
AFIEEHHGFAAIDDILSGRGLERVFAFVAHEAGESRVLNSAAIMSACVDDSDDLAVETVQ
YFVRLTAMVIANLALVQLPFGGIYLVGGLSGAIAPFMKDANFEAAFLDKGRFADFMTDFG
IYVVQDDYAALKGNAAYLNGVLQG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacccttcgcaaaagtattccttggttgcagatattggcggtacgaacacgcgc
gtggctttatgcgatggtgtagacgtgctcaaccccacgatccggcgctatcgcaatgcg
gaaaatgacgggttcacctccgttctggcgcagtatcttgccgccgaggggaatgtgcgg
ccaaaggctgtctgtgttgcgatcgcagggcccgtcaatggcggcaaggggcggctgacc
aatcttgactgggacatggacgccgaagaaatagccaaggcgacaggggccgcacatgtg
gccttgctcaatgacttgcaggcgcagggatatgcgcttgatcaactggcatccgatgat
cttgcctgcgtgcgccaagggtctgcaacggccaaaggcaacgcgcgtcttgtcgtaaac
cttgggacggggttcaatgcctccccggttttcatgacgcaggccggtgcctatgtggcc
acgtctgaaagcggccatgccaacatgccgatccgaacggatcaggacctgcggctctgt
gcgttcatcgaggaacatcacgggtttgccgcgattgatgacatcctgtcgggccgcggg
ctggagcgtgtctttgccttcgtggcgcatgaggctggcgaaagtcgcgtgttgaactcg
gcagccatcatgtccgcgtgtgtggatgacagcgatgaccttgcggtcgaaactgtgcag
tatttcgtgcgcctgacggcgatggtcattgccaatcttgcgttggtgcaactgcccttc
ggtggcatttatctggtgggcgggctgtccggcgcaatcgcgccgttcatgaaggacgcg
aatttcgaagcggcgtttctggacaaaggccgctttgcagatttcatgacagatttcggt
atttatgtcgtgcaagacgattatgccgcgctgaaaggcaatgcggcctatttgaacggt
gttttgcagggctaa

DBGET integrated database retrieval system