KEGG   Roseobacter litoralis: RLO149_c006680Help
Entry
RLO149_c006680    CDS       T01572                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rli  Roseobacter litoralis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RLO149_c006680 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RLO149_c006680 (glk)
   00052 Galactose metabolism
    RLO149_c006680 (glk)
   00500 Starch and sucrose metabolism
    RLO149_c006680 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RLO149_c006680 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RLO149_c006680 (glk)
   00524 Butirosin and neomycin biosynthesis
    RLO149_c006680 (glk)
Enzymes [BR:rli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RLO149_c006680 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
693553..694527
Genome map
AA seq 324 aa AA seqDB search
MPHPSQKYSLVADIGGTNTRVALCDGVDVLNPTIRRYRNAENDGFTSVLAQYLAAEGNVR
PKAVCVAIAGPVNGGKGRLTNLDWDMDAEEIAKATGAAHVALLNDLQAQGYALDQLASDD
LACVRQGSATAKGNARLVVNLGTGFNASPVFMTQAGAYVATSESGHANMPIRTDQDLRLC
AFIEEHHGFAAIDDILSGRGLERVFAFVAHEAGESRVLNSAAIMSACVDDSDDLAVETVQ
YFVRLTAMVIANLALVQLPFGGIYLVGGLSGAIAPFMKDANFEAAFLDKGRFADFMTDFG
IYVVQDDYAALKGNAAYLNGVLQG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacccttcgcaaaagtattccttggttgcagatattggcggtacgaacacgcgc
gtggctttatgcgatggtgtagacgtgctcaaccccacgatccggcgctatcgcaatgcg
gaaaatgacgggttcacctccgttctggcgcagtatcttgccgccgaggggaatgtgcgg
ccaaaggctgtctgtgttgcgatcgcagggcccgtcaatggcggcaaggggcggctgacc
aatcttgactgggacatggacgccgaagaaatagccaaggcgacaggggccgcacatgtg
gccttgctcaatgacttgcaggcgcagggatatgcgcttgatcaactggcatccgatgat
cttgcctgcgtgcgccaagggtctgcaacggccaaaggcaacgcgcgtcttgtcgtaaac
cttgggacggggttcaatgcctccccggttttcatgacgcaggccggtgcctatgtggcc
acgtctgaaagcggccatgccaacatgccgatccgaacggatcaggacctgcggctctgt
gcgttcatcgaggaacatcacgggtttgccgcgattgatgacatcctgtcgggccgcggg
ctggagcgtgtctttgccttcgtggcgcatgaggctggcgaaagtcgcgtgttgaactcg
gcagccatcatgtccgcgtgtgtggatgacagcgatgaccttgcggtcgaaactgtgcag
tatttcgtgcgcctgacggcgatggtcattgccaatcttgcgttggtgcaactgcccttc
ggtggcatttatctggtgggcgggctgtccggcgcaatcgcgccgttcatgaaggacgcg
aatttcgaagcggcgtttctggacaaaggccgctttgcagatttcatgacagatttcggt
atttatgtcgtgcaagacgattatgccgcgctgaaaggcaatgcggcctatttgaacggt
gttttgcagggctaa

DBGET integrated database retrieval system