KEGG   Roseobacter litoralis: RLO149_c006790Help
Entry
RLO149_c006790    CDS       T01572                                 

Definition
xylose isomerase family protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rli  Roseobacter litoralis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RLO149_c006790
   00051 Fructose and mannose metabolism
    RLO149_c006790
Enzymes [BR:rli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     RLO149_c006790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
704154..705140
Genome map
AA seq 328 aa AA seqDB search
MKQENTPLFAARLNAFKIGADAYWPGKNKVTTADLLARAATAGLTAADLNYPDHFANDTP
AQLSDALQDSGMVLNGMAMRYYTDPGYKLGAFTHPDASVRRAAIDETKRGLDVLADMGGR
LMTLWMGQDGFDYSFQMDYARAWENTIAAITEVADHNPDLDIALEYKPNEPRAFALMPDA
ATTLLALKEIDRPNTGVTLDFAHVLYADEMPAFAAALVARHSRILGVHLNDGYGKWDNGL
MVGAVHPVQTIELLVELTRAGYDGAIYFDTFPDHSGLDPVAEARTNIDVVNRLRAIAQSL
AGDADLQAAIARQDAPLSMRLVQAAMLK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagaaaacacacccctgtttgctgcaaggctcaatgcattcaaaatcggtgcc
gacgcctattggccggggaaaaataaggtcacaaccgctgatctgctggcgcgcgcggca
acggcagggctcacggcggcggatctgaattacccggatcattttgcaaacgacacgcct
gcccagctttcggatgctttgcaggacagtggtatggtgctcaacggcatggccatgcgg
tattatacggatccggggtataaactgggggccttcacgcatcctgatgccagcgtccgg
cgcgcggcgattgacgaaaccaagcgcgggcttgacgtgctggcggatatgggcgggcgt
ttgatgacgctttggatggggcaggatggtttcgactattcgttccagatggactatgcc
cgcgcgtgggaaaacacgatcgcggcgatcactgaggttgcggatcacaacccggacctt
gatatcgcgttggaatataaacccaatgagccgcgcgcctttgccctgatgcccgatgcg
gccacgacccttcttgcgctcaaggagattgaccggcccaataccggtgtcacccttgat
tttgcccatgtgctttatgccgatgagatgcccgcctttgccgccgccctcgtggcgcgt
cattcgcgcatccttggtgtgcatcttaacgatggctacggcaaatgggacaacgggctg
atggtgggtgccgtgcatcccgtgcagaccattgaactgctcgtggaactgacgcgtgca
ggatatgatggcgcgatctatttcgatacgttcccggaccattccggccttgatcctgtc
gcagaggcgcgcaccaatatcgacgtggtgaaccgtctgcgcgcgattgcgcagagcctc
gccggggacgctgatctgcaagcggccatcgcccgacaggatgcgcccttgtccatgcgt
ctggtacaggcggccatgctgaaatga

DBGET integrated database retrieval system