KEGG   Roseobacter litoralis Och 149: RLO149_c006790Help
Entry
RLO149_c006790    CDS       T01572                                 

Definition
xylose isomerase family protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rli00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rli00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
704154..705140
Genome map
AA seq 328 aa AA seqDB search
MKQENTPLFAARLNAFKIGADAYWPGKNKVTTADLLARAATAGLTAADLNYPDHFANDTP
AQLSDALQDSGMVLNGMAMRYYTDPGYKLGAFTHPDASVRRAAIDETKRGLDVLADMGGR
LMTLWMGQDGFDYSFQMDYARAWENTIAAITEVADHNPDLDIALEYKPNEPRAFALMPDA
ATTLLALKEIDRPNTGVTLDFAHVLYADEMPAFAAALVARHSRILGVHLNDGYGKWDNGL
MVGAVHPVQTIELLVELTRAGYDGAIYFDTFPDHSGLDPVAEARTNIDVVNRLRAIAQSL
AGDADLQAAIARQDAPLSMRLVQAAMLK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagaaaacacacccctgtttgctgcaaggctcaatgcattcaaaatcggtgcc
gacgcctattggccggggaaaaataaggtcacaaccgctgatctgctggcgcgcgcggca
acggcagggctcacggcggcggatctgaattacccggatcattttgcaaacgacacgcct
gcccagctttcggatgctttgcaggacagtggtatggtgctcaacggcatggccatgcgg
tattatacggatccggggtataaactgggggccttcacgcatcctgatgccagcgtccgg
cgcgcggcgattgacgaaaccaagcgcgggcttgacgtgctggcggatatgggcgggcgt
ttgatgacgctttggatggggcaggatggtttcgactattcgttccagatggactatgcc
cgcgcgtgggaaaacacgatcgcggcgatcactgaggttgcggatcacaacccggacctt
gatatcgcgttggaatataaacccaatgagccgcgcgcctttgccctgatgcccgatgcg
gccacgacccttcttgcgctcaaggagattgaccggcccaataccggtgtcacccttgat
tttgcccatgtgctttatgccgatgagatgcccgcctttgccgccgccctcgtggcgcgt
cattcgcgcatccttggtgtgcatcttaacgatggctacggcaaatgggacaacgggctg
atggtgggtgccgtgcatcccgtgcagaccattgaactgctcgtggaactgacgcgtgca
ggatatgatggcgcgatctatttcgatacgttcccggaccattccggccttgatcctgtc
gcagaggcgcgcaccaatatcgacgtggtgaaccgtctgcgcgcgattgcgcagagcctc
gccggggacgctgatctgcaagcggccatcgcccgacaggatgcgcccttgtccatgcgt
ctggtacaggcggccatgctgaaatga

DBGET integrated database retrieval system