KEGG   Roseobacter litoralis: RLO149_c007150Help
Entry
RLO149_c007150    CDS       T01572                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
rli  Roseobacter litoralis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RLO149_c007150
Enzymes [BR:rli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     RLO149_c007150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
759551..761299
Genome map
AA seq 582 aa AA seqDB search
MKASKTTSFSMRLASLVRQIYPDIDADILSSKIVEAFWPEGAKPRKRGRLPGNNLWTEKD
ALLITYGNSILDGSHKPLDLLHDFLLRYMKGVVNGVHILPFFPFTSDDGFAVSDFRAVNP
QLGDWADINRIGGAFHLMSDLVLNHVSSQGAWFNAYRQGQVPYDRFFFEASPDDDLSAVV
RPRTTPLLQKIETVNGPRHVWCTFSHDQIDLDFRNPEVLLEFLRIIRLHVDNGVQIIRLD
AVAFLWKEVGSPSIHLPQTHAIVQLMRMLCDYAAETIILLTETNVPKAENLSYFGNRNEA
HAIYNFPLPPLILHAMMSGSARYLRRWQSGMPPAQLGCAYLNFTASHDGIGMRPAEGLLP
PQEQAQMIQTVRDIGGLVSMRALPDGGEAPYELNTTFIEATSRTFKGEDDRHFDRFICSQ
TIVMSLEGIPAFYIHSMLATSNDHGQVERRGMNRAINRHRWDYPSLQAQLADPETIHAKV
LGALSARLRLRARQSAFHPNATQFTMSLDDRVFGVWRQSLDRFQSVFALHNVSDEVVDIP
AASMNLIDDEDWVDILSGEKIDVFADAITLAPYQCRWITNKI
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccagtaagacgacctccttcagcatgcgcctcgcatcgctcgtccgtcagatt
tatccagacattgacgctgatatcctctccagcaagatcgttgaggcgttctggcctgaa
ggcgccaagccgcgcaagcgggggcgcttgccgggcaacaatctgtggactgaaaaagac
gcgctgctgattacctatggcaactctatactggacgggtctcacaagccgcttgatctg
cttcatgattttctgctgcgctacatgaaaggcgtggtgaatggcgtgcacatcctgcca
ttttttccatttacgtctgacgatggctttgcggtatctgactttcgggcggtaaatccg
cagctaggtgattgggccgatataaaccggatcgggggtgcgtttcaccttatgtccgat
cttgtgctgaaccatgtgtccagccagggggcgtggttcaatgcctaccggcaggggcag
gtgccctatgatcgcttctttttcgaggcgtcccccgatgatgatctgtcggcagtggtc
cggccgcgcaccacacccttgctgcagaaaatcgaaaccgtgaacgggccgcgccatgtc
tggtgtacctttagccacgaccagatcgatctggatttccgcaacccggaggtcttgttg
gagtttctgcgcattatccgactgcatgtagacaatggtgttcagatcatccgcctcgat
gccgtcgcgtttctgtggaaagaggtgggttcaccgtcgatccatttgccgcagacccat
gcgattgtgcagctcatgcgcatgctgtgcgactacgcggcggagacgatcattctgctg
accgaaaccaacgtgcccaaggccgaaaacctcagctatttcgggaaccgtaatgaggcg
catgcgatttacaactttccgctgccgccactgatcctgcatgccatgatgtcggggtcc
gcccggtacctgcggcgctggcaaagcgggatgccacccgcgcaattgggctgtgcctat
ctgaacttcacggccagccacgatgggatcggaatgcgcccggcagaagggcttctgccg
ccacaggaacaggcgcagatgatccagacggtccgggacattggcgggctcgtatccatg
cgcgcactgccggacgggggtgaagcgccctacgagttgaacacgacatttatcgaggct
acatcgcgtaccttcaagggagaggatgaccggcattttgaccggtttatctgctctcag
acaatcgtgatgtctctcgaagggatcccggctttctacatccattccatgctcgcgaca
tccaatgatcatgggcaggtcgaaaggcggggtatgaaccgggcgatcaaccggcatcgg
tgggattatccaagcttgcaggcgcaactggcggatcctgagacaatccatgcaaaagtt
ctcggtgccctgtccgcgcgcttgcgtctgcgggcgcggcaatccgcatttcaccccaat
gccactcagtttaccatgtctttggatgatcgggtctttggagtatggcggcaaagtctg
gaccgctttcagtcggtattcgccttgcacaatgtgagtgacgaggtcgtagacattcct
gccgcctcaatgaacctcatcgatgacgaagactgggtggatattctgagcggcgaaaag
attgacgtttttgctgacgcgattacccttgccccttatcaatgccgctggattacaaac
aaaatctaa

DBGET integrated database retrieval system