KEGG   Roseobacter litoralis: RLO149_c007280Help
Entry
RLO149_c007280    CDS       T01572                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rli  Roseobacter litoralis
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RLO149_c007280
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RLO149_c007280
Enzymes [BR:rli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     RLO149_c007280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
775093..776343
Genome map
AA seq 416 aa AA seqDB search
MRYFGDLISNVFDRRYSSFLAGQSDDRPINELCEALLGSRGEISGGSLARCVLERYGEMD
ASEKGAFFHYLCDGLGISPQEVFRALESYQAHPSRSTYKAFSAASEPRRQELIRRLNRIE
DATRDLVAMRADLLAMMPNHPRLAPLDVDFKHLFASWFNLGFLMLRPINWNSPAAILEKI
IAYEAVHMIESWEDLRRRMQPEDRRCFAFFHPAMGDEPLIFVEVALTKGVPHSIQHLLSD
TREELAAHDTDTAVFYSISNCQPGLAGISFGNSLIKQVVADLAREFPQVRQFVTLSPIPG
LRAWAEGAGLSLAGDPEEVRSLASCYLTQVKRADGLPLDPVARFHLGNGAYIHAVHAEAD
TSENGLRQSGGAMVNYCYDLAQIPQNHESFVGQQRVAASKDVVNLAQKTPVQPAGD
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgaggtattttggcgatctgatttcaaatgtatttgatcgccggtactcaagttttctg
gcggggcaatcggatgaccgtccgataaatgaactctgtgaggcgttgttgggcagtcgc
ggcgaaatctccgggggcagtctggcgcgttgcgtgttggagcgttatggcgagatggat
gcatccgagaaaggcgcgttcttccactatttgtgcgacgggttgggcatctcaccgcaa
gaggtgtttcgggcgcttgaatcctatcaggcgcatccgtcaagatcgacatacaaagcg
ttttcagccgccagtgagccacgccgtcaggaactgatccgtcgcctgaaccggatagaa
gatgcgacccgggatctggtcgcgatgcgcgccgacttgctggcaatgatgcctaaccat
ccgcgacttgcgccgcttgatgtggatttcaagcacttgtttgcctcgtggttcaacctt
ggttttctgatgttgcgcccgatcaactggaacagcccggcggcgatccttgaaaagatc
atcgcttatgaggcggttcatatgatcgagagttgggaggacttacggcgcaggatgcag
cccgaggaccggcgttgctttgcgtttttccatcccgccatgggggatgaaccgctgatc
ttcgtcgaagtcgcgttgaccaaaggtgtgccgcactccatccagcacctcttgtcagac
acacgcgaagaactggcagcgcatgacacggatacggcggtgttttattcgatttcaaac
tgtcagccgggccttgcaggaatttcgtttgggaattcgttgatcaagcaggttgtcgcg
gatcttgcgcgcgagtttccacaggtccgtcagtttgtgactttgtccccgatccccggt
ttgagggcctgggcggagggggcggggttgtctttggctggtgatcctgaagaggtccgc
tcccttgcgtcctgttacctgacgcaggtcaaacgcgccgatggattgccccttgatccg
gtggcgcgatttcatttgggaaatggcgcctatatccacgcagtccatgctgaagcggac
acgtcggaaaacgggcttcggcaatctgggggggcaatggtgaattactgctacgatctt
gcacaaatccctcagaaccacgaaagctttgtgggacaacagcgcgttgccgcatcaaag
gatgtggtaaatctggcgcaaaagacaccggtgcaaccggcaggagactga

DBGET integrated database retrieval system