KEGG   Roseobacter litoralis Och 149: RLO149_c007450Help
Entry
RLO149_c007450    CDS       T01572                                 

Gene name
cuyA
Definition
(S)-cysteate sulfo-lyase CuyA (EC:4.1.1.79)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:rli00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
797596..798609
Genome map
AA seq 337 aa AA seqDB search
MHLARFPRRFLAHLPTPLERLDRLTRELGGPEIWIKRDDCTGMSTGGNKTRKLEFLMAEA
ELEGADIVLTQGATQSNHARQTAAFAAKMGMQCHIVLEDRTGSNNANYNNNGNVLLDHLH
GATTEKRPGGGDFNALIEEMAVEMRADGKKVYTIPGGGSNPTGALGYVNCAFEMLNQVNS
SGIKIDHMVTATGSAGTQAGLIVGLKAMNAQIPLLGIGVRAPKPKQEENVYNLACKTAEK
LGCPGVVAREDVVANTDYVGEGYGIPTDSGLEAIQMFAELEAILLDPVYSAKGAAGFIDL
IRKGHFKKGERVVFLHTGGSVALFGYDAAFDFSNRWS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttgcccgctttccccgccgttttcttgcgcacttgcccacaccattggagcgc
cttgaccgcctgacccgggaattgggcgggccggagatctggatcaagcgggatgattgc
accggcatgtccacaggcggcaacaagacccgcaagctggaattcctgatggcagaggcg
gaattggagggggccgatatcgtgctgacccaaggcgccacgcaatcaaaccacgcgcgt
cagacagcggccttcgcggcaaagatgggcatgcagtgtcacatcgtgctcgaagatcgc
acgggatcgaataacgccaactataacaacaacggcaacgttttgctggatcatttacat
ggtgcgacgactgaaaaacgccccggcggcggcgatttcaatgcgctgatcgaagagatg
gccgtggaaatgcgtgcagatggcaagaaggtttacaccattccgggcggtgggtcgaac
ccgaccggggctttgggttatgtcaactgtgcctttgaaatgctgaatcaggtgaacagc
agcgggatcaaaatcgaccacatggtcacggccaccggaagtgcgggcacgcaggcgggt
ttgattgtcgggctgaaggcgatgaacgcgcagattcccctgttgggcatcggcgtgcgc
gcacccaaacccaaacaggaagagaacgtctataatctggcctgcaaaacggctgaaaaa
ctgggctgccccggcgttgtggcgcgcgaagacgtcgtggccaacactgattatgtgggc
gaaggctatggtatccccaccgacagcggtcttgaggccattcagatgtttgccgagctg
gaagcgatcctgctggatcctgtctattcggcgaaaggggcggcagggtttatcgatctg
atccgcaaaggccacttcaaaaagggcgaacgtgtggttttcctgcataccggcggctct
gtggccctgtttggctatgacgcggcgttcgatttttcaaaccgctggtcctga

DBGET integrated database retrieval system