KEGG   Roseobacter litoralis: RLO149_c008400Help
Entry
RLO149_c008400    CDS       T01572                                 

Gene name
tpiA1
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
rli  Roseobacter litoralis
Brite
Enzymes [BR:rli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     RLO149_c008400 (tpiA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
904190..904966
Genome map
AA seq 258 aa AA seqDB search
MSEPSFWIGTSWKMNKTLAEGLDFARALAAADGARDPRIQRFVVPPFPFVRDIKAALADT
SVKVGAQNMHWEDAGAWTGEVSAPMLLDCGLDLVELGHSERRAHFGETDETVGLKVAAAV
RHELIPLICIGETLEEREAGRAKEVLAAQVSAALARVTGTAPVLLAYEPVWAIGEHGIPA
TSEYADARQAEIIDVAGEMLGRRVPCLYGGSVNQDNCEELIRCPHIDGLFIGRAAWDATG
YLKILEKSAATLDLGETT
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccgtctttttggattggcaccagttggaagatgaacaagacgcttgccgaa
gggctggattttgcccgcgcgctcgccgcagcggatggtgcgcgtgatccgcgcatccag
cggttcgtcgtgccgccctttcctttcgtgcgcgacatcaaggctgcattggccgatacc
tcggtcaaggtcggggcgcagaatatgcattgggaggatgcaggcgcgtggacgggcgaa
gtttccgcaccgatgcttttggattgcggcttggaccttgtggaactgggacactccgag
cggcgcgcgcattttggcgaaacggatgagaccgtggggctgaaggtggcggcggctgtg
cggcatgagttgatccccttgatctgcatcggcgaaacgctggaggaacgcgaggcgggg
cgcgccaaagaggtgctggccgcgcaggtcagcgccgcgctggcgcgggttactggcacc
gcgccggtcttgctggcctatgaaccggtctgggcgattggtgaacatggcatccccgcg
acatcagaatatgccgacgcgcgacaggccgagatcatcgacgttgcaggcgagatgctg
ggacggcgggtgccctgcctatacggcgggtcggtcaatcaggacaattgcgaggaattg
atccgctgcccgcacattgacgggctgttcatcgggcgcgcggcgtgggacgcgaccggc
tatctgaaaattctggaaaaatctgcggcaaccttggacttgggagaaacgacatga

DBGET integrated database retrieval system