KEGG   Roseobacter litoralis: RLO149_c008400Help
Entry
RLO149_c008400    CDS       T01572                                 

Gene name
tpiA1
Definition
triosephosphate isomerase TpiA (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rli  Roseobacter litoralis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RLO149_c008400 (tpiA1)
   01230 Biosynthesis of amino acids
    RLO149_c008400 (tpiA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RLO149_c008400 (tpiA1)
   00051 Fructose and mannose metabolism
    RLO149_c008400 (tpiA1)
   00562 Inositol phosphate metabolism
    RLO149_c008400 (tpiA1)
Enzymes [BR:rli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RLO149_c008400 (tpiA1)
Exosome [BR:rli04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RLO149_c008400 (tpiA1)
  Exosomal proteins of bladder cancer cells
   RLO149_c008400 (tpiA1)
  Exosomal proteins of melanoma cells
   RLO149_c008400 (tpiA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
904190..904966
Genome map
AA seq 258 aa AA seqDB search
MSEPSFWIGTSWKMNKTLAEGLDFARALAAADGARDPRIQRFVVPPFPFVRDIKAALADT
SVKVGAQNMHWEDAGAWTGEVSAPMLLDCGLDLVELGHSERRAHFGETDETVGLKVAAAV
RHELIPLICIGETLEEREAGRAKEVLAAQVSAALARVTGTAPVLLAYEPVWAIGEHGIPA
TSEYADARQAEIIDVAGEMLGRRVPCLYGGSVNQDNCEELIRCPHIDGLFIGRAAWDATG
YLKILEKSAATLDLGETT
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccgtctttttggattggcaccagttggaagatgaacaagacgcttgccgaa
gggctggattttgcccgcgcgctcgccgcagcggatggtgcgcgtgatccgcgcatccag
cggttcgtcgtgccgccctttcctttcgtgcgcgacatcaaggctgcattggccgatacc
tcggtcaaggtcggggcgcagaatatgcattgggaggatgcaggcgcgtggacgggcgaa
gtttccgcaccgatgcttttggattgcggcttggaccttgtggaactgggacactccgag
cggcgcgcgcattttggcgaaacggatgagaccgtggggctgaaggtggcggcggctgtg
cggcatgagttgatccccttgatctgcatcggcgaaacgctggaggaacgcgaggcgggg
cgcgccaaagaggtgctggccgcgcaggtcagcgccgcgctggcgcgggttactggcacc
gcgccggtcttgctggcctatgaaccggtctgggcgattggtgaacatggcatccccgcg
acatcagaatatgccgacgcgcgacaggccgagatcatcgacgttgcaggcgagatgctg
ggacggcgggtgccctgcctatacggcgggtcggtcaatcaggacaattgcgaggaattg
atccgctgcccgcacattgacgggctgttcatcgggcgcgcggcgtgggacgcgaccggc
tatctgaaaattctggaaaaatctgcggcaaccttggacttgggagaaacgacatga

DBGET integrated database retrieval system