KEGG   Roseobacter litoralis Och 149: RLO149_c009710Help
Entry
RLO149_c009710    CDS       T01572                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rli  Roseobacter litoralis Och 149
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rli00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rli00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1018795..1019259
Genome map
AA seq 154 aa AA seqDB search
MARAENGAIGRDGTIPWNVPEDLKFFQRETLGGALIMGRNTWESLPVKPLPRRFNVVVSS
NSDTAEVVAPSVKVAIELAIEHGHQRIYGIGGAAIYQEMLPLAHRLLISEVQIDVPDADT
FFPNFDVAGWKAIDTRPLRGQAPACSVHEYLRLM
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgtgcagaaaacggcgcgatcggacgtgacgggacaatcccatggaatgtccct
gaggatcttaagttctttcagcgcgaaaccttgggcggcgcgctgataatggggcgcaac
acttgggagagcctcccggtgaagcctctgcccagacgttttaacgtcgtggtttcatca
aattcggatactgcggaagtggttgcacccagtgtaaaggttgccattgagcttgcgata
gagcacgggcatcagcgaatttatggtattggtggtgcagcaatttaccaggaaatgctg
ccattggcacatcgcttgttgatttctgaagtgcagatcgacgtccctgatgccgatacg
tttttcccaaattttgacgtagcgggttggaaggcaatcgacacgcgtccgctgcgcggg
caggcgcctgcctgttctgtgcatgagtatctgaggttgatgtag

DBGET integrated database retrieval system