KEGG   Roseobacter litoralis Och 149: RLO149_c010460Help
Entry
RLO149_c010460    CDS       T01572                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rli00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1091906..1092820
Genome map
AA seq 304 aa AA seqDB search
MLERGRPSQVIPATDAPPAVLTTLTRERVSIAGLDFNKPRVMGILNVTPDSFSDGGTHHS
VADALAGAAQMVGVDLLDVGGESTRPGAQLVPALEEIERTAPVIQALRQAGHAMAISIDT
RKTPVAEAAIDAGATLVNDVSGFTFDADLAPLCAARQVPVCVMHAQGDPATMQARPEYDD
VLLDVYDFLALQIDRLVQIGVPRDQIIADPGIGFGKTLEHNLRLLSHLSLFHALGVPILL
GASRKKFIGTLGGAEKARDRMPGSLAVALAALKHGTQIVRVHDVPQTLQAIALWRAVVAG
HGHG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgctggaacgggggcgcccgtcacaggtcattcccgccacggatgcgccaccggctgtt
ttgacaactctcacccgagaacgcgtgtcgattgccgggctggattttaacaaaccgcgt
gtcatggggattttgaacgtgacgccggatagcttttcggacggcggcactcatcattcg
gttgctgacgctttggcaggtgcggcccaaatggtcggtgtggacctccttgatgtgggg
ggggaatccacccgaccgggtgcacagctggtgccagcactggaagaaatcgaacggaca
gcgccagttattcaagctctgcgccaggcgggccacgcgatggccatttcgatcgacacc
cgcaaaacacctgtcgccgaggccgcgatcgacgcgggggccacattggtgaatgatgtt
tccgggtttacgtttgatgctgatctcgcgccgctttgtgctgcgcggcaggtgcccgtc
tgtgtcatgcatgcgcagggggatcccgcaaccatgcaggcccgacccgagtatgacgac
gtgctgctggatgtatacgactttctggcgctgcaaattgaccggctggtgcagatcggt
gtgccgcgcgatcagatcattgctgaccccgggattggtttcggcaaaacgcttgagcac
aatctcagactgctatcgcatctgtccctgtttcatgcgttgggcgtgccgatcctgttg
ggggcgtcgcgcaaaaagttcatcggaacactcggcggggccgaaaaggcgcgtgaccgg
atgccggggtcattggcggtcgcgctcgcggctttgaaacatgggacacaaattgtgcgc
gttcatgacgtgccacagaccctgcaggccattgcgctttggcgtgcggtcgtggcagga
catgggcatggataa

DBGET integrated database retrieval system