KEGG   Roseobacter litoralis: RLO149_c012330Help
Entry
RLO149_c012330    CDS       T01572                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rli  Roseobacter litoralis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RLO149_c012330 (ruvA)
Enzymes [BR:rli01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RLO149_c012330 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1269587..1270243
Genome map
AA seq 218 aa AA seqDB search
MIGKITGRLEYRTTDHVLIDVRGVGYLVFCSERTLAALPGVGEVVALYTDLLVREDVMQL
FGFTTLTEKEWHRLLTSVQGVGAKASLAILGTLGADGVSRAIALGDWNAVKAAKGVGPKI
AQRVVLDLKDKAPSVMGMRDTQAIASADATDTVIETTATPAPVLQNPSAQAEALSALSNL
GYGPGDAAGAVAEAAGEMPEAETPDLIRAALKRLAPKG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgattggcaagatcacaggccgtcttgaatatcgcacaacggatcacgtgctgatagat
gtgcgcggcgtcgggtatctggtcttttgctcggaacgtacattggcggctctgccgggt
gtgggcgaggtcgtcgcgttatatacggacctgctggtgcgcgaggacgtgatgcagctt
tttggtttcaccacgctcacggaaaaggaatggcatcgattgctgacctccgtacagggg
gtcggggccaaggcgtcgcttgcaatcctcggcaccctcggggcggatggcgtcagccgg
gccatcgctctcggcgattggaacgcggtcaaggcggccaagggggtcggcccaaaaatc
gcgcaacgcgtcgttcttgacctcaaggacaaagcaccaagcgtcatgggcatgcgcgac
acgcaagccatcgcaagcgctgatgccacagacacggtcattgaaacgacggccacgcca
gccccggtgttgcaaaacccatcggcacaggccgaggctctgtcagccctgtccaatctg
ggctatggtccgggggacgcggcgggcgctgtggctgaggcggcaggcgagatgcctgag
gcagaaacgcctgatctgatccgggcggcattgaaacggctcgcacccaaaggatag

DBGET integrated database retrieval system