KEGG   Roseobacter litoralis Och 149: RLO149_c015650Help
Entry
RLO149_c015650    CDS       T01572                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rli00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1610896..1613091
Genome map
AA seq 731 aa AA seqDB search
MNISVTDAEKLAEGRHSNPFSILGLHEVSGKLCVRAFLPGADAVEAIDPKTGRIIVKLDL
TESPGLFAGTAARRKKRFAYHLRVTQGAHQWQMDDPYRFGPVMGDMDEYLLGEGSHRQLW
TALGAHVITHEGVSGTHFAVWAPNAARVSVVGVFNVWDGRRTVMRQRGASGVWEIFIPGI
SDGEIYKYEIMTADGSILPQKADPVGFGSEHPPRTGSVVRKIDGYEWDDSPWMSRRAQLQ
RINQPISIYEVHLGSWRRVPEDANRPLSYIELAEQLVAYVKDMGFTHIELMPISEFPFDG
SWGYQPVGLFAPTIRHGTVDEFRALISACHRENIGVILDWVPGHFPEDAHGLGKFDGTAL
YEHADRKEGFHPDWNTLVFNYGRAEVANYLAANALYWLQEHHVDGLRVDAVASMLYRDYS
RKDGEWIPNKDGGRENYEAISFLQKVNTETYGEVSGIMTIAEESTAFPGVSAPVDAGGLG
FGFKWNMGWMNDTLSYMQQDPIHRKYHHDKMTFGLHYAFSENFILPLSHDEVVHGKGALL
DKMPGQGDDKFANLRAYYGFMWGHPGKKLLFMGCEFAQGIEWNHDSSLDWHLLDHPQHRG
MRNLVRDLNALYRDSAALYALDCAPQGFEWVDENNAEASVFAWLRHGGDGVAPMLVVSNF
TPVARSNYRLGVPNAGRWVERLNTNADCYGGTGLGNLGGVHSAEIAADGKAFSIEVVLPP
LTTLFFQLEGI
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatctcagtaacagacgctgaaaagcttgctgaagggcgtcacagtaatccgttt
tcgatacttggcctgcatgaggtatcgggaaagctctgcgtgcgggctttcctgcccggt
gcggatgccgtcgaggcaatcgacccaaagaccgggcgtataatcgtgaaactcgacctc
acggaatcgccgggcctttttgccggcactgccgcgcggcggaaaaaacgatttgcctac
cacctgcgtgtcacacaaggcgcgcatcagtggcagatggatgatccgtatcgttttggt
cctgtcatgggcgatatggatgagtacctcctcggcgaaggatcacatcggcaattgtgg
actgcactgggtgctcatgtgatcactcatgaaggggtatctggcacgcatttcgccgtc
tgggcgccaaatgccgcccgtgtgtcggtggttggggtgttcaacgtctgggatggccgt
cgcaccgtgatgcgccagcgcggtgccagcggtgtctgggagatcttcatcccgggcatc
agcgatggtgagatttacaaatacgaaatcatgaccgcagacggatcaattttgccgcaa
aaggcggatcccgtcggatttgggtcagagcaccccccgcgcaccggatcggtcgtgcgc
aagattgacggttatgaatgggacgacagcccgtggatgtcccggcgcgcgcagttgcag
cgcatcaaccagcctatttcgatctatgaagtgcaccttggatcgtggcggcgtgtgccg
gaagacgcaaatcgcccgctcagctatatcgaactggctgagcaactggtcgcctatgtc
aaggacatgggatttactcatatcgaattgatgccgatctcggaatttccctttgatggc
tcgtggggatatcagccggttggtctttttgcaccgacgatccggcacggcacagttgat
gagttccgcgcgctgatctcggcctgtcatcgcgaaaacatcggcgtgatcctcgattgg
gtgccggggcattttcccgaggatgcgcatgggttgggcaagtttgacggcacagccctt
tatgagcatgcggaccgcaaggaagggttccatcccgactggaacacgcttgtcttcaat
tacgggcgtgccgaagtcgcaaactatctggcggcgaacgcgctttattggctgcaggag
catcacgtcgatggcctgcgtgtcgatgccgtcgcctcgatgctatatcgcgactattcc
cgcaaggacggcgaatggattccgaataaggacggcgggcgcgaaaactacgaagccatt
tcatttttgcaaaaggtgaacactgaaacctacggcgaggtttccgggatcatgaccatt
gccgaagaatccacagcattcccgggcgtgagcgcgccggtggacgcggggggcctcggc
tttgggttcaagtggaacatgggctggatgaacgatacgctgagttacatgcagcaggat
ccgatccaccgaaaataccaccacgacaagatgacctttggcttgcactatgctttttcc
gaaaacttcatcctgccgctcagtcatgatgaagttgtgcatggcaaaggtgctttgctg
gacaaaatgccggggcagggcgatgataaattcgctaacctgcgcgcctattatggcttt
atgtgggggcatccgggcaaaaagctgctgtttatgggctgcgagtttgcacagggcatc
gagtggaaccacgacagcagtcttgactggcatctgttggaccacccgcaacaccgcggt
atgcgaaatcttgtgcgtgatctgaacgcgctctaccgggatagcgcggcgctctacgcg
ctggattgtgcgccacaaggctttgaatgggttgacgaaaataacgctgaggcgtcagtc
tttgcctggcttcgacatggtggggatggcgtcgcaccgatgctggtggtgagcaatttc
acaccggttgcgcgatcgaattatcgtctcggcgtcccaaatgccggacggtgggtggag
cggctgaataccaatgcggattgctatggcgggaccggtctgggcaatttgggtggggtg
catagcgcagagattgcggcggacggcaaggcattttcgatcgaagtggttctgcctccg
ctcacgacactgttttttcagttggaaggtatttga

DBGET integrated database retrieval system