KEGG   Roseobacter litoralis Och 149: RLO149_c015690Help
Entry
RLO149_c015690    CDS       T01572                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rli00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1617933..1619933
Genome map
AA seq 666 aa AA seqDB search
MNADLYLSQLAAEVGVFAEFNDMQGVTHVTSPETQAALIRANGYSAQTPAEVRETLEALR
ADKDAAYVQDEIVVACDHPQHIVCTRPVAWSVLAEGSHQVLAEGRSETHISLPALPMGVH
ALVLNGANGPQEACLIAAPAQAPSLQQIAQTKRCWGVMAALYGLGSRSGQHIGSFADLAE
AAAIFGRCGAGFLGINPVHALGMAAGDTISPYSPTHRGFLNTDHIAPLTPNPAETPVGDL
LDYAQHRRLQRPALQREFEAFLGYATVPESKAFDAFCDVEGARLVEFAVFEQVSQKHGPD
WRDWPQALHDPKNALHETSNVDLMFHKWLQWRADTQLDVAQQTARAAGMALGLYLDLAVG
ARVGGAETWGTETATAEGVSLGAPPDHLSPAGQNWQLAALSPVKLKATRYAALRAILAKN
MKHAGLMRIDHALGLSRSFWIPQDGSPGAYMRQPLKSLVALIAIEAQRAGTVIVGEDLGL
VPDGFRAEMAGHGFYGYSVLQYEKDAKGVLLTPDHLRAQSLACFGTHDTPTLSGFWKGRD
IDWWHRLGWIDEGAAARARRSRSKEKRQLSAIPAPERLPKDVTAAVRDKVHADLAASPAA
LVAVQLDDVLSLTEAQNLPGTIEAHPNWRRRYPVSGAALAKNKALKATGTIMARAGRNIA
DRKEDG
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgatctgtatttgtcccagctcgctgcggaagtgggtgttttcgccgagttt
aacgacatgcagggcgtcactcatgtgacctcgccggaaacgcaagctgctctgatacgc
gccaatggatatagcgcgcaaacaccggcagaagttcgcgaaacacttgaggccctgcgc
gctgacaaggacgcagcctacgtacaggatgagatcgtcgtagcctgtgatcacccgcaa
cacatcgtgtgtacccgtccggttgcgtggtcggttttggccgaagggtcgcatcaggtt
ctggcagaagggcggagcgagacgcatatttcactgcccgctttgccgatgggggtgcat
gctcttgtgcttaacggcgcaaatggtccgcaggaagcctgcctgatcgccgcacctgca
caagccccgtcactgcagcagatcgcccaaacgaaacgctgctggggggtgatggcagca
ttatacgggcttgggtcacgcagcggacaacacatcggtagttttgcggatctggctgag
gctgccgcgatctttggccgatgtggcgcggggtttcttggtatcaacccggtacatgcg
ctcgggatggcggcgggggacacgatcagcccttattcccccacacatcgcggctttctc
aacaccgaccatatcgcgcctttgacgccaaacccggctgaaaccccagttggtgatctg
ctggattatgcgcagcatcgccggcttcagcggcctgctttgcaacgtgagttcgaagcg
tttctgggctacgccacggtgccggaaagcaaagcgttcgatgcgttttgcgatgtcgaa
ggggcgcgactggtcgagtttgcagttttcgaacaggtcagccagaaacatgggcccgat
tggcgcgactggccgcaggctttgcatgacccgaaaaatgcactgcacgagacatcaaac
gtggatttgatgtttcacaaatggctgcaatggcgcgctgatacacagcttgatgtggca
caacagacggcgcgtgctgcagggatggcgttggggctataccttgatctggctgtgggc
gcgcgcgtcggtggcgcggaaacctggggcacagagacggccaccgccgagggcgtatcc
cttggtgcgccgcctgatcacctcagcccggcgggacagaactggcagcttgcggcgctt
tctccggtcaagctcaaggcgacgcgctatgccgccctgcgcgctatccttgcgaaaaac
atgaaacacgcaggccttatgcggatagaccacgccttggggctgagccgcagtttctgg
ataccgcaggatggcagccccggtgcctatatgcgtcagccgctgaagtctctggtcgca
ctgatcgcgatcgaggcgcagcgtgccggcacggtgattgtcggcgaagacctcggcctt
gtgcccgatggatttcgtgctgagatggcgggacatggcttttatggctattccgtgctg
caatatgaaaaagacgcaaaaggcgtgcttttgacaccggatcatttgcgcgcgcagtct
ctggcttgctttggcacgcatgacacaccgacgctgtcgggtttctggaaggggcgtgat
attgactggtggcaccgtcttggctggattgatgaaggcgcggcagcgcgtgcgcggcgt
tcccggtcaaaggaaaagcgccaattgtcggcgatacccgcacctgaacgcctgccgaaa
gatgtgacggcggctgtgcgagacaaggtgcatgcggacttggctgcatcgcctgcagct
ttggtggcagtgcagcttgacgatgttttatctttgacagaggctcagaatctgccgggc
acgattgaagcgcacccgaactggcggcggaggtacccggtgagcggtgcagcactcgcc
aagaataaagcgttgaaggccacgggcacgatcatggcccgtgcaggacgaaacatagca
gaccgaaaggaagatggatga

DBGET integrated database retrieval system