KEGG   Roseobacter litoralis Och 149: RLO149_c015760Help
Entry
RLO149_c015760    CDS       T01572                                 

Gene name
rafA
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rli00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rli00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:rli00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1626712..1628796)
Genome map
AA seq 694 aa AA seqDB search
MTECWRLDDARQTLALASTNGRCPQVIYWGAPLPPGEDLCALSDVSTLDVTGGMLDQNPD
LSLCPEAARSFPGQPGLIVRDRDGTPFLPKFRLDHVTQSELTLTVTCVDAANQLTYVAEF
TLDADTHVIAMTARLSADRPLHLHWLAAPVLPAPQHSEEMIDFAGRWCGEFQMNRTAWSP
GIRYRENRTGRTGHEHFPGLVVPCKGATNTAGEAYAFHYGWSGGHRMIAEELPDGRRQIQ
FGHAARMETAAATEFRTAPLYAVYSCDGLNGCAVSFQRHVRDRIVSWTETGRPRPVHYNC
WEAVYFKHDLPVLKDIATRAAALGAERFVLDDGWFGQRDDDTSSLSDWEVDPRKYPDGLG
PLIDFIHAQDMSFGIWFEPEMINPNSNIHRAHPHWALGAEDQILGRQQKALNMALPEVRD
FLYQRISALLSAHPIDYIKWDHNRVLPMPDAAQTRGSYALMDRLRADFPHVEIESCASGG
GRIDFGILHRTQRVWLSDSNDALERLKMQHNAALFLPSCVTGSHVGPRKCHTSGRILDIE
FRAWVAAQRHMGFEMDPRELTDEEADVLRDVSQWWKNNRDWMDTGDILRLDAADPSVIAE
QQLARNGGQFVVFVGKSGTSDQIAPRPLRLTRLEPEARYEVSLRNRKAASHLSRGSLALK
DGPVTLSGAALMQNGLTLPWSFPESMWVLEGRRL
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
gtgacagagtgctggcggctggatgacgcgcgccagacgctggcgcttgcctcgacaaat
gggcggtgcccgcaggtcatttactggggcgcgcccctgccaccgggcgaagacctgtgc
gcgctcagcgatgtcagcacgctcgatgtgacgggtggcatgctggatcagaacccggat
ctgtcgctctgccctgaggctgcacgcagcttcccgggccagcccggtctcattgtgcgt
gaccgggacggcacgcctttcctgccgaaattccggctggatcacgtgacgcagtccgag
ctgaccttgaccgtgacctgcgtcgacgcggccaaccaactgacctatgtggcggaattt
acgctcgatgccgacacccatgtgatcgccatgacagcacggctatctgctgaccgaccg
ctgcatctgcactggctggccgcccctgtcctgcccgccccgcaacatagcgaggagatg
attgatttcgcaggccgctggtgtggtgaattccagatgaaccgcaccgcatggtcgccg
ggcatccgctaccgcgaaaaccgcacggggcgcaccggccacgagcattttcccggtctg
gtcgttccctgcaagggggcgaccaataccgcaggtgaggcttatgcctttcactacggc
tggtccggcgggcaccggatgatcgccgaagaattgcccgatggccggcgccagatccag
ttcggccacgccgcccgcatggaaacggctgccgccactgaattccgtaccgccccgctt
tatgcggtctattcctgcgacggtctcaacggctgcgcggtctcctttcaacgccatgtg
cgcgaccggatcgtcagctggaccgagacgggccgcccgcgcccggtgcattataactgc
tgggaagcggtctatttcaaacacgacctgccggtgctcaaggacatcgccacacgggcc
gccgcccttggtgcggagcgtttcgtgctggatgatggctggttcgggcagcgcgacgat
gacacctcgtcgctgtcggactgggaagtggacccgcgcaaatacccggacgggttgggg
ccgctgatcgattttatacatgcacaagacatgagttttggcatctggttcgagccggaa
atgatcaatccgaattccaacatccaccgcgcccatccccattgggcgttgggggcagag
gatcaaatccttggccgtcagcaaaaggcgctcaacatggccttgccggaggtgcgcgat
ttcctctatcagcgcatatctgcgctgctctctgctcaccccatcgactacatcaaatgg
gaccacaaccgggtcttgcccatgcccgatgcggcccagacccgcggctcctatgcgctg
atggatcggctgcgcgccgattttccgcatgtggaaattgaaagctgcgcttcgggtggc
gggcggattgatttcggcatcctgcaccgcacgcaaagggtctggttgtccgatagcaat
gatgcgctggaacggctgaagatgcagcacaacgccgcgctttttttaccttcctgcgtc
accggcagccatgtggggccgcgcaaatgccatacctcgggccgtatattagacattgaa
ttccgcgcttgggtggcggcacaacgccatatggggtttgagatggacccgcgcgagttg
accgacgaggaagcagacgttctgcgtgatgtttcccagtggtggaagaacaaccgcgac
tggatggacacaggcgatatcctgcggctggatgcggcggacccgtcggtcattgccgaa
cagcaacttgcccggaacggcggccaattcgtggtctttgtcggtaaatccggcacgtcg
gatcagatcgccccgcgccctttgcgcctgacccggctggagccagaggcgcgttacgag
gtcagcctgcgcaatcgcaaggccgcatcgcatctgtcgcggggctctttggccctcaag
gacggccctgtcacgctgagcggggcagccctgatgcaaaacggcctcacgctgccatgg
agttttcccgaatccatgtgggtgctggagggccgccgcctgtga

DBGET integrated database retrieval system