KEGG   Roseobacter litoralis: RLO149_c017320Help
Entry
RLO149_c017320    CDS       T01572                                 

Definition
agmatinase
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
rli  Roseobacter litoralis
Brite
Enzymes [BR:rli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     RLO149_c017320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1776689..1777657
Genome map
AA seq 322 aa AA seqDB search
MTDAPFSFQPVSAMEVPRFAGVPTFMRLPFVPLESPHIAQVDIGLVGVPWDTGTTNRPGA
RHGPRQLRDLSTMIRARHPVSGVEPFMARNCADLGDCPVNPADTMDTLDRVSTYFKSLKA
AGITPLVAGGDHLITLPVLRGLAQNAPLGLVHFDAHTDLFDSYFSGCKFTHGTPFRRAIE
EGLLDPKRMIQIGIRGTRGGDDVEWGLEQGIRIVTIEELYDLGLDAVMEEARTVVGDQPT
YLSFDIDSIDPSFAPGTGTPEIGGFTTFEAQKMVRQLSGLNLVGADLVEVSPPFDPSGGT
AWVGVSLMFEILCLLCENASDP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgccccgttttcgttccaacccgtgtccgcaatggaggtgcctcggttcgct
ggcgtgcccacttttatgcgcctgcctttcgtgccgcttgagtccccgcacatcgcgcaa
gttgatatcgggctggtgggtgtgccttgggacacaggcaccacaaaccgtccaggtgcg
cgccacggaccacgccaattgcgcgacttgtccactatgatccgcgcccgtcatcctgtg
tcgggggtggaacctttcatggcccgcaattgtgcggaccttggcgattgcccggtcaac
ccggctgacaccatggatacccttgatcgggtgtccacgtatttcaaatctctcaaagcc
gccgggattacacctttggttgcgggtggcgaccaccttatcactttgcccgtgctgcgt
ggattagcccaaaacgcgccgctcggattagtgcattttgatgcgcataccgacctgttt
gacagctacttctcaggatgcaagttcacccacggcactccgtttcggcgcgccatcgaa
gaaggtctgctcgaccccaaacgcatgatccagatcgggattcgcggcacacggggcggt
gacgatgtggaatgggggttggaacagggtattcggatcgttaccatagaagagctttat
gacttgggacttgacgcagtcatggaggaagcgcgcactgtcgtaggcgatcaaccaacc
tatctgtcgtttgacatcgacagcatcgacccgtcttttgcacctggcacgggtactccg
gagattggcggattcacgacgttcgaggcacagaaaatggtgcgccaattgtcggggctg
aacctcgtgggtgctgacctggttgaagtcagtccgcccttcgatccgtcaggtggcacc
gcttgggttggcgtgtcgttgatgttcgagattttgtgcctgctgtgtgaaaacgcttcg
gacccttag

DBGET integrated database retrieval system