KEGG   Roseobacter litoralis Och 149: RLO149_c018140Help
Entry
RLO149_c018140    CDS       T01572                                 

Gene name
bdhA
Definition
D-beta-hydroxybutyrate dehydrogenase BdhA (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rli00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rli00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1865813..1866598
Genome map
AA seq 261 aa AA seqDB search
MSFEISLSGKTAIVTGSNSGIGLGIARELARAGADIVLNSFTDNAEDHDLAKEIAQETGV
TARYIQADMSKADECRALITKAGTCDILINNAGIQHVAGIPDFPVEKWDAIIAINLSSAF
HTTAIALPMMRAAGWGRVINIASAHGLTASPYKSAYIAAKHGIVGLTKTTALETAKEPIT
ANAICPGYVLTPIVEKQIPDTMKEYDMTREEVIENVMLTRQPSKEFATVEQMGGTATFLC
SDAAAQITGTTISVDGGWTAL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgagatttctctttccggtaaaaccgccatcgtaacggggtcaaactcgggc
atcgggctgggtattgcgcgtgagttggcgcgcgctggcgcagacatcgtgctcaattct
ttcacggataatgccgaggatcacgaccttgcaaaggagattgcgcaggaaacaggtgtc
actgcgcggtatattcaggctgatatgtccaaagccgatgagtgtcgcgccctgattaca
aaggctggcacctgcgatattctgatcaacaatgcaggcatccaacatgttgcgggcatt
cccgatttcccggtcgagaaatgggatgcgatcatcgcgatcaacctgtcctcggctttt
cacaccacggccattgcattgccgatgatgcgtgctgcgggctggggcagggtaatcaac
atcgcctcggcgcatgggttgaccgcatcaccctataaatcggcctatatcgccgccaaa
catggcatcgtcggcttgaccaagacgacggcactggaaaccgcgaaggaaccgatcacc
gccaatgcgatctgccccggttacgtgctgacacccattgtcgaaaagcaaattcccgac
acgatgaaggaatatgatatgacacgcgaagaggtcatcgagaacgtgatgctcacgcgg
caaccgtccaaagagtttgcaacggttgagcagatgggcggcacggcgacgtttctgtgc
tcggatgctgcggcgcaaattaccggcactaccatcagcgtcgatggaggctggacggcg
ctgtaa

DBGET integrated database retrieval system