KEGG   Roseobacter litoralis Och 149: RLO149_c018360Help
Entry
RLO149_c018360    CDS       T01572                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rli00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1888492..1889478)
Genome map
AA seq 328 aa AA seqDB search
MTDHSYASGRLDLPFVGISTFGKRPYVADWDTLDADVAVFGAPFDGGTQWRAGARFGPRG
VREASTLFSFGHAGAYDHEDDATYLPADIRIVDMGDADIVHTATEKSHENIETGVRAALR
AGALPVVIGGDHSINIPCIRAYNGPEYSCGAFHILQIDAHLDFVDERHGVRHGHGNPMRR
AAEQSYVSGLTQVGIRNVSSTAREGYADARAMGSQIISVRQARKMGLEKLLDSVPAGVPV
YITIDIDAFCPSIAPGTGTPSHGGFLYYEVLELLQGVAGRNPIIGLDLVEVAPDYDPTGC
TSILAAQLLLNTIGFIFHARGQSPTLVP
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcatagttacgcgagcggcaggctggatttaccttttgtgggcatctcaaca
tttggcaagcgcccctacgtggccgactgggatacactggacgctgatgttgccgtcttt
ggtgcgccctttgatggcggcacccaatggcgggccggggcacggtttggcccgcgcggt
gtgcgtgaggcgtccactctgttcagctttggtcacgcaggcgcttatgatcacgaggat
gatgcgacctatctgcctgccgatatcaggatcgtcgatatgggcgatgcggatatcgtg
cataccgcaaccgaaaaaagccatgaaaacatcgaaaccggcgtgcgggccgccctgcgc
gcaggcgcgctgcctgtggtgatcggcggggatcattccatcaacatcccctgcattcgg
gcctataacgggccggaatacagctgcggggcatttcatatcctgcagattgatgcgcat
ctggattttgtcgatgagcgccacggggtgcgccacgggcatggcaatccgatgcgccgt
gccgccgaacagagctatgtcagcgggttaacgcaagttggcattcgcaatgtcagctcg
accgcacgcgaaggatacgcagatgcccgcgccatgggctcgcagatcatatcggtgcgt
caggcgcgcaagatggggcttgaaaagctgcttgatagcgtgcccgccggggtgcctgtc
tacatcacgattgatattgatgcattctgcccctccatcgcgccggggacgggcacgccc
agccatggcggatttctatattatgaagtgcttgagctgttgcagggcgtggcggggcgc
aacccgatcatcggccttgatctggtggaggtagcaccggattatgaccccaccggctgc
acctccattctggcggctcagcttctgctgaatacgattggtttcatctttcacgcgcgg
ggacagtcgccaacgcttgtgccctag

DBGET integrated database retrieval system