KEGG   Roseobacter litoralis: RLO149_c018360Help
Entry
RLO149_c018360    CDS       T01572                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rli  Roseobacter litoralis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RLO149_c018360
Enzymes [BR:rli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RLO149_c018360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1888492..1889478)
Genome map
AA seq 328 aa AA seqDB search
MTDHSYASGRLDLPFVGISTFGKRPYVADWDTLDADVAVFGAPFDGGTQWRAGARFGPRG
VREASTLFSFGHAGAYDHEDDATYLPADIRIVDMGDADIVHTATEKSHENIETGVRAALR
AGALPVVIGGDHSINIPCIRAYNGPEYSCGAFHILQIDAHLDFVDERHGVRHGHGNPMRR
AAEQSYVSGLTQVGIRNVSSTAREGYADARAMGSQIISVRQARKMGLEKLLDSVPAGVPV
YITIDIDAFCPSIAPGTGTPSHGGFLYYEVLELLQGVAGRNPIIGLDLVEVAPDYDPTGC
TSILAAQLLLNTIGFIFHARGQSPTLVP
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcatagttacgcgagcggcaggctggatttaccttttgtgggcatctcaaca
tttggcaagcgcccctacgtggccgactgggatacactggacgctgatgttgccgtcttt
ggtgcgccctttgatggcggcacccaatggcgggccggggcacggtttggcccgcgcggt
gtgcgtgaggcgtccactctgttcagctttggtcacgcaggcgcttatgatcacgaggat
gatgcgacctatctgcctgccgatatcaggatcgtcgatatgggcgatgcggatatcgtg
cataccgcaaccgaaaaaagccatgaaaacatcgaaaccggcgtgcgggccgccctgcgc
gcaggcgcgctgcctgtggtgatcggcggggatcattccatcaacatcccctgcattcgg
gcctataacgggccggaatacagctgcggggcatttcatatcctgcagattgatgcgcat
ctggattttgtcgatgagcgccacggggtgcgccacgggcatggcaatccgatgcgccgt
gccgccgaacagagctatgtcagcgggttaacgcaagttggcattcgcaatgtcagctcg
accgcacgcgaaggatacgcagatgcccgcgccatgggctcgcagatcatatcggtgcgt
caggcgcgcaagatggggcttgaaaagctgcttgatagcgtgcccgccggggtgcctgtc
tacatcacgattgatattgatgcattctgcccctccatcgcgccggggacgggcacgccc
agccatggcggatttctatattatgaagtgcttgagctgttgcagggcgtggcggggcgc
aacccgatcatcggccttgatctggtggaggtagcaccggattatgaccccaccggctgc
acctccattctggcggctcagcttctgctgaatacgattggtttcatctttcacgcgcgg
ggacagtcgccaacgcttgtgccctag

DBGET integrated database retrieval system