KEGG   Roseobacter litoralis: RLO149_c021780Help
Entry
RLO149_c021780    CDS       T01572                                 

Definition
di-heme cytochrome c peroxidase-like protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rli  Roseobacter litoralis
Brite
Enzymes [BR:rli01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     RLO149_c021780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2225366..2227078)
Genome map
AA seq 570 aa AA seqDB search
MGLVDFFRRHFLGNFFKADCRVRVPADRGKRVPHIGAHKVRCGQAAAHFVIPADTRLRTG
MALHGRAQIPFKRALVIAGPSQTHGIDDTDQFLRFGIARTRRGPKRRIGLVKSTRIHQIA
RRFQFRRDRRGQKSEGKSYCAHGVVLSCFASLAAAADLPPPLTDEDFIEFDVAQAALGQA
LFYDPILSGNRNITCAHCHHPEFGTGDGLSLGIGEGGQGVGPDRTPGAGADRVAKRIPRN
APGLWNLGARDLYTMFHDGRLSLSDIYGNGFNSPAQEWLPEGLNSLLAAQALFPLVAQFE
MAGNPGENDVIGAVHDRIDAAWPILAKRVRTDADYGPAFVAAFDEIDTAQQVSIVHIANA
LAAFMALEWRSTDSPFDAYLAGDEAALNRGERAGMALFYGKAACADCHAGSLMSDQKFHA
LGLPAFGPGRTRAFDPYARDVGRMAESNRLRDAYAFRTPMLRNVALTAPYGHNGAYPTLE
GIIRHHLDPVAARAAWQRQMAQLPDIAWLAATDFILGADALEMDRQERAIAVTPMHLTDA
EIAELVAFMHALTGASVNTPAFGIPPDFVP
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgggccttgttgatttcttccgccgtcattttcttggcaacttcttcaaggctgattgc
cgcgtcagggtccccgccgatcgcggaaagcgtgtaccacatataggcgcgcataaggtc
cggtgcgggcaggccgcggcccacttcgtaataccagccgacacccgattgcgcaccggg
atggcccttcatggccgcgcgcagataccattcaaacgcgcgctggtcatcgcggggccg
tcccagacccatggcatagatgacaccgatcagttcctccgcttcggcattgcccgaacg
cgccgcgggccaaagcgccgcataggcctcgtcaaatcgacccgcatccatcagatcgcg
cgccgcttccaattccgccgcgaccggcgtggccaaaagagcgagggcaaaagctattgt
gcgcatggggtcgttttgtcctgttttgcatcgctggccgcagccgcagatttaccaccg
ccgctgacggatgaggatttcatcgaattcgacgtagcgcaagcggcactggggcaagcg
ctgttttatgatccgatcctgtcgggcaatcgcaatatcacctgtgcccattgccatcat
ccggaatttggcacgggcgacgggctgtccctggggatcggtgagggcgggcagggggtg
gggcctgatcgcacgcccggtgcgggcgcggatcgggtggccaaacgcatcccacgcaat
gcgccgggcctgtggaatctgggtgcgcgtgatctgtacacgatgttccatgacgggcgg
ctgagcctgtcggatatctacggcaacgggttcaattcacccgcgcaggagtggttgccc
gaagggttgaattcgctgctggccgcccaggcgctgttccccctcgtggcccagttcgaa
atggcgggtaatccgggcgaaaatgacgtaatcggcgctgtgcatgaccgcattgatgcg
gcatggccgatccttgcaaaacgggtgcgcacggatgctgactatggcccggccttcgtg
gcggcctttgacgagatcgacacggcgcagcaggtcagcatcgtgcacatcgcaaatgcg
ctggcggccttcatggcgctggaatggcgcagcaccgacagcccatttgatgcctatctt
gccggggatgaggcggcgttgaaccgtggtgaacgggcggggatggcgttgttctacggc
aaagccgcttgtgctgactgccacgcgggatcgctgatgagtgatcagaagtttcatgcc
ttgggccttccagcattcgggccggggcgcacgcgtgcattcgatccttatgcccgcgat
gtggggcgcatggccgaaagcaaccggttgcgcgatgcctatgcctttcgcacgccaatg
ctgcgcaatgtggctttgaccgcgccttatgggcacaacggggcctatccgacgctcgaa
ggcatcattcgccatcatctggacccggtggcggcaagggctgcatggcagcgccagatg
gcgcagcttcccgatattgcgtggctggcggcaacggatttcattctgggcgctgacgca
ttggaaatggaccgacaggaacgggcaatagcggtgacacccatgcacctgacggatgct
gaaatcgcggaattggtcgccttcatgcatgcgttgaccggggcaagcgtcaatacgcct
gcgtttggcataccgccggatttcgtgccttag

DBGET integrated database retrieval system