KEGG   Roseobacter litoralis: RLO149_c023360Help
Entry
RLO149_c023360    CDS       T01572                                 

Definition
(GenBank) putative regulatory protein
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rli  Roseobacter litoralis
Pathway
rli02020  Two-component system
rli02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rli00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RLO149_c023360
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RLO149_c023360
Enzymes [BR:rli01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     RLO149_c023360
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RLO149_c023360
Two-component system [BR:rli02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RLO149_c023360
Bacterial motility proteins [BR:rli02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RLO149_c023360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest CheR PAS_3 CheR_N PAS_4 PAS_9 PAS IncA EzrA PAS_10 HMMR_N OmpH PAS_8 Tropomyosin Golgin_A5 AAA_23 Spc7 Fez1 APG6 Seryl_tRNA_N CENP-F_leu_zip DUF3450 Atg14 HAUS-augmin3 HemX Mnd1 DUF1664 DUF812 Jnk-SapK_ap_N Rootletin IFT57 ZapB ATG16 Exonuc_VII_L RPW8 Snapin_Pallidin FapA TPR_MLP1_2 FliD_N Tropomyosin_1 HIP1_clath_bdg Reo_sigmaC Fmp27_WPPW TMF_TATA_bd
Motif
Other DBs
NCBI-ProteinID: AEI94306
UniProt: F7ZBC0
Position
complement(2396011..2399265)
Genome map
AA seq 1084 aa AA seqDB search
MTDDNKEITIIGIGSSAGGLEAIRELVATLPTKMKVAYVVVQHMSPHHKSLMTELVARQT
SLIVKDVKDSILPEPNVIYITPPNTDIIYDEGKLRLVEPSHEVASPKPSVDRFLLSLADQ
HGEKSMAIILSGTGTDGAYGVQAIREAGGITIAQDTESAKYDGMPMSAMQTGCVDLVLRP
FEIGTHLQKILSSARDFDAFRQETSETSPALDLLQILLARTRVDFREYKQTTINRRIERR
MVALGIESHAEYTQFCRVNPNAVDALFKDLLISVTRFFRDKSEFEQLKEMLPALLKKKSN
PPFRVWIAGCATGEEAYSIAILLSEALGGPTVNLKDHVQIFATDIDKDALDVARKGVYGM
AALNDIPKSLSDRYFMTQNDGIRVIDSLRSAILFSDHNVCQDPPFQKVDLLCCRNLLIYF
GNALQHKVMSRFHYAMTDNSLMFLGTAETVAGSDEMFVQDSHSAHIYRRRSIRRTDQNVF
SNPRNLPKSRSKVPMQIKQGQDPGQSTDRQMFEALALALGKNSVLVTDDYGIIRVYGNVS
PFIEMNETSNLKMHIDLLRRPFREEARSLVTLALKHGEHRSGVRHLLAEDDDAEIRLDVY
PIIARDINERAALVVFTEVQVDRSKASGASEVDEDSIFESDRIRLLEDEVATTREALQQT
IEELETSNEELQSLNEELQSTNEELQATNEELETSNEELQSTNEELITVNEELQVTAAEL
SGRTGELMSVLETAPLSIMVLDTALQISQATNAACDMFNLTRPVSNPHISQCVLPNSFPP
LAPICNETLKLGEPITKEFNSGGSRYKLTSSPFFDMRGQMKGVTMVVSAFPGLAQELDLI
LDHGEIYMLNRAQDGTILRISEKSARFFGTTRHKAEGANFYNLVSRSISNTIREHDAQLL
KTNDGHLQDMLRLRSVEDKKEVCLNSENFLFPDPSGDDASIYTIGQDISEVIETRDKAED
ALAQLILLQEIARIGFWSLDLEDETVFWSEEVYRIHGKDPDTFSPKLEDGLSFYHPEDRE
TVQAEVERVRTQGGEFHFKLRIINEDGETIPIESFGLARQDVNGNIGKIIGVFRVSEDNT
STVH
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
gtgacagacgacaataaagaaataactatcatcgggatcgggtcttcggccggtggtctc
gaagcgatacgcgagcttgtcgcaacattgccgacaaaaatgaaagtggcctatgtggtg
gtgcaacacatgtcaccccatcacaaaagcctgatgacagaattggttgcgcgccagaca
agtctgatcgtcaaagacgtcaaggacagcattctgccagagccgaatgtcatctacatc
acgccccccaataccgatattatctatgatgagggcaagttacgtcttgtcgaacccagc
catgaggtggcatcgccgaaaccatccgttgaccggtttctgctgagcctcgcggatcaa
catggtgaaaaatcgatggctattatcttgtccggcacaggcaccgatggcgcctatggt
gtgcaggcgatccgtgaggcgggcgggattacgattgcacaagacaccgaaagtgcaaaa
tatgacggcatgccaatgtctgcgatgcaaacgggctgcgttgatctggtgttgcgcccc
ttcgaaatcgggacgcatctgcaaaagatcctgtcgtctgcacgcgactttgacgctttc
cgccaggaaacgtccgagaccagcccggcattggatctgttgcaaatcctgcttgcaagg
acgcgggtggattttcgcgagtacaagcaaaccacgatcaaccggcggattgagcgccgc
atggtggccctggggatcgaaagtcatgcggaatatacgcagttttgtcgcgtaaacccg
aacgctgtggatgcactgttcaaagatctgctgatttctgtcacgcggttctttcgcgac
aaatcggagtttgagcaactcaaggagatgctgccggcgctgctgaagaaaaagtcaaac
ccaccgttcagggtctggatcgcgggatgtgcgaccggggaagaagcctattcgattgcg
atcctactgtccgaagctctcggtggccctacggtaaatctgaaagaccatgtccagatc
tttgcgactgacatcgacaaagacgccttggacgtcgcgcgcaagggcgtctatggcatg
gccgcgctgaacgacatccccaaaagcctgtctgatcgctatttcatgacccagaacgat
ggcatccgggtcatcgattccctgcgctccgccattttgttttctgatcacaatgtatgt
caggacccgccctttcaaaaagtggatttgctctgctgtcgtaacctgttgatatatttt
ggaaacgccttgcagcataaggtcatgtcacggtttcactacgccatgactgacaactcc
ctgatgttcctgggaacggcggaaacggtcgctggctcggacgaaatgttcgtacaggac
agccattcggcccatatctacagacgccgctcgatccggcgaacggatcagaacgtgttt
tccaacccgcgcaacctgccaaaatcgcgcagcaaggtgccgatgcagatcaaacagggg
caggatccggggcaatccacggaccggcaaatgttcgaggcgctggcactggctctgggc
aagaattcggtgttggtgacggatgactacgggatcatcagggtctacggaaacgtcagc
ccgttcatcgagatgaacgaaaccagtaacctgaagatgcacattgatctgctgcgcaga
ccgtttcgtgaagaagcgcgcagcctcgttacacttgctttgaagcatggcgaacaccgc
agcggcgtgcgccatctgcttgcggaagacgacgacgccgaaatcaggctcgacgtttac
cccatcatagcacgcgacataaacgagcgcgcggccttggtggtctttaccgaggtgcag
gtcgatcgcagcaaagcctccggtgcttcggaagtcgatgaggactcgatttttgaaagc
gacagaatacgcttgctcgaagatgaagtggcgacaaccagagaagcgctgcagcagacc
atcgaggagttggaaacttccaatgaggaactgcaatccctgaatgaggaattgcaatcc
acaaatgaagaactgcaggcaaccaacgaagagttggaaacatccaacgaagaattgcag
tccaccaacgaagagctgatcactgtcaacgaagagcttcaggtcacggcggcggaattg
agcggtcgcacgggcgaactgatgtcagtgctggaaaccgcgccgctgtcgatcatggtg
ctcgataccgccttgcagatatcacaagcgaccaatgccgcctgcgatatgttcaatttg
acgcgtccagtgtcaaatccgcatattagccaatgcgtcctgcccaatagttttccgccc
ttggcgccgatctgcaatgaaacactcaaactgggcgagcccattacaaaggaattcaat
tcgggtggttcgcgatacaagctgacaagttcgccgttttttgacatgcgcggtcaaatg
aaaggggtcacgatggttgtttcggcctttccgggacttgctcaggagttggacctcatt
ctggatcatggcgaaatctacatgctgaaccgcgcgcaggatggcaccattttgcggatc
agcgagaagtcagcgcggtttttcggcaccacgcgtcacaaggcggaaggtgccaatttc
tacaatctggtttcgagaagtatttccaataccattcgggaacatgatgcccaactattg
aaaaccaatgatggtcacctgcaggatatgctgcggctccggtctgttgaggataaaaag
gaagtctgcctgaattcagagaattttctgtttcctgacccgtcaggggacgacgcttcg
atttacacgatcgggcaggatatctccgaagtcatagaaacgcgcgataaggccgaggat
gcgcttgcacagctcatactgttgcaagaaatagcgcgcattgggttttggtcgctggat
ttggaagatgaaacggttttctggtccgaagaggtgtaccgcatccatggcaaggatcct
gataccttttccccaaagctggaagatgggttgtcgttctatcaccccgaagaccgcgaa
accgtgcaagctgaagtggaaagagtgcgcacacaaggcggagagtttcattttaaactg
cgcatcatcaacgaggatggtgaaacgatcccgattgagtcgttcggcttggcccgccaa
gacgtgaacggcaacattggcaagatcatcggtgtgtttcgtgtcagcgaggacaacacc
agcaccgtacactga

DBGET integrated database retrieval system