KEGG   Roseobacter litoralis: RLO149_c023380Help
Entry
RLO149_c023380    CDS       T01572                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rli  Roseobacter litoralis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RLO149_c023380 (galM)
   00052 Galactose metabolism
    RLO149_c023380 (galM)
Enzymes [BR:rli01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     RLO149_c023380 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2400262..2401230
Genome map
AA seq 322 aa AA seqDB search
MITLRSASLSAQVLPFGATLAGLWYNGHPHSLVIGSTDADAYAEKLRYFGALIGPIANRI
SGATLCIDGATCKMEPNEGSSCLHSGADGLHARDWTVVRQSPSAVSLRCFLRDGANGLPG
NRTVNVDYSLTDAGHLILEMTASSDRTTAINLAHHPYWNLGNCETVKDHRLTIYADKYLP
VDAHTLPTGEISPVSGTAYDFQTGRLVPTDQTLDANLCLAETRRDHPTPAARLSGPSGLM
LQIDTTEPGLQVYNGSGLNDIKNSLHDQRVLQPFSGIALEPQAWPDAPRHSAFPSIILRV
GETYRQKTTYRIWDELNQIATV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgataactttgcgctccgcatccctgtccgctcaagtcctgcccttcggtgcgacgttg
gcgggactttggtacaatgggcacccgcacagtcttgtgattggttcaaccgacgcagat
gcatatgcggagaaactgcgctatttcggcgccctgatcggccccatcgccaaccggatt
tccggcgctacgctttgcatcgatggtgccacctgcaagatggagccgaatgaaggcagc
agttgtctgcacagcggggccgacgggctgcatgcgcgcgactggacggtcgtccggcaa
tccccttctgctgtctcattgcggtgctttctgcgcgatggggcaaatgggttgccgggc
aatcggacggtcaatgtggactacagcctgacggatgcgggccatctcattctggaaatg
actgcgagcagcgaccgcacaacggccatcaacctcgcacatcacccctattggaacctt
ggcaattgcgaaacggtgaaagatcaccgtctgacgatctatgcagataaatacctgccc
gtggatgcgcacaccctgccaacgggagagatttcacctgtctcgggcacggcatatgat
tttcaaacggggcgacttgtcccgacagatcaaacgctggatgcaaatttatgtcttgcc
gaaacgcggcgagaccaccccacaccagcagcgcgcctgagcgggccatctgggctgatg
ctacagatcgatacgaccgaacccggcttgcaagtatacaatggaagcggattaaatgat
atcaaaaattctctgcatgatcaacgggttttgcaacccttctcaggtatcgcattagaa
ccgcaagcctggcctgacgcgccacgccacagcgcctttcccagcattattctacgcgtg
ggtgaaacataccggcaaaaaaccacctatcgcatttgggacgaattgaaccaaatcgcc
acagtctga

DBGET integrated database retrieval system